Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P04275: Variant p.Gln852Arg

von Willebrand factor
Gene: VWF
Feedback?
Variant information Variant position: help 852 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamine (Q) to Arginine (R) at position 852 (Q852R, p.Gln852Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (Q) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 852 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2813 The length of the canonical sequence.
Location on the sequence: help QGKEYAPGETVKIGCNTCVC Q DRKWNCTDHVCDATCSTIGM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         QGKEYAPGETVKIGCNTCVCQDRKWNCTDHVCDATCSTIGM

                              QGQEYAPGETVKIDCNTCVCRDRKWNCTDHVCDATCSAIGM

Mouse                         QGAEYAPGDTVKIGCNTCVCRERKWNCTNHVCDATRSAIGM

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 764 – 2813 von Willebrand factor
Region 826 – 853 CX
Glycosylation 857 – 857 N-linked (GlcNAc...) asparagine
Alternative sequence 315 – 2813 Missing. In isoform 2.
Beta strand 847 – 852



Literature citations
Nucleotide sequence of pre-pro-von Willebrand factor cDNA.
Bonthron D.; Orr E.C.; Mitsock L.M.; Ginsburg D.; Handin R.I.; Orkin S.H.;
Nucleic Acids Res. 14:7125-7128(1986)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANTS ARG-852; ALA-1381 AND HIS-1472; Structure of the gene for human von Willebrand factor.
Mancuso D.J.; Tuley E.A.; Westfield L.A.; Worrall N.K.; Shelton-Inloes B.B.; Sorace J.M.; Alevy Y.G.; Sadler J.E.;
J. Biol. Chem. 264:19514-19527(1989)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS ILE-471; ARG-852; ALA-1381 AND HIS-1472; Full-length von Willebrand factor (vWF) cDNA encodes a highly repetitive protein considerably larger than the mature vWF subunit.
Verweij C.L.; Diergaarde P.J.; Hart M.; Pannekoek H.;
EMBO J. 5:1839-1847(1986)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1400 (ISOFORM 1); VARIANTS ARG-484; ARG-852 AND ALA-1381; Amino acid sequence of human von Willebrand factor.
Titani K.; Kumar S.; Takio K.; Ericsson L.H.; Wade R.D.; Ashida K.; Walsh K.A.; Chopek M.W.; Sadler J.E.; Fujikawa K.;
Biochemistry 25:3171-3184(1986)
Cited for: PROTEIN SEQUENCE OF 764-2813; VARIANTS ARG-852 AND ALA-1381; Cloning and characterization of two cDNAs coding for human von Willebrand factor.
Sadler J.E.; Shelton-Inloes B.B.; Sorace J.M.; Harlan J.M.; Titani K.; Davie E.W.;
Proc. Natl. Acad. Sci. U.S.A. 82:6394-6398(1985)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 744-873 AND 1289-2813 (ISOFORM 1); VARIANTS ALA-789; ARG-852 AND ALA-1381; cDNA sequences for human von Willebrand factor reveal five types of repeated domains and five possible protein sequence polymorphisms.
Shelton-Inloes B.B.; Titani K.; Sadler J.E.;
Biochemistry 25:3164-3171(1986)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 781-1424 (ISOFORM 1); VARIANTS ARG-852 AND ALA-1381;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.