Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P04637: Variant p.Cys176Phe

Cellular tumor antigen p53
Gene: TP53
Feedback?
Variant information Variant position: help 176 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Phenylalanine (F) at position 176 (C176F, p.Cys176Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In sporadic cancers; somatic mutation. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 176 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 393 The length of the canonical sequence.
Location on the sequence: help RVRAMAIYKQSQHMTEVVRR C PHHERCSDSDGLAPPQHLIR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         RVRAMAIYKQSQHMTEVVRRCPHHERCSD-SDGLAPPQHLIR

                              CVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHLI

Rhesus macaque                RVRAMAIYKQSQHMTEVVRRCPHHERCSD-SDGLAPPQHLI

Mouse                         RVRAMAIYKKSQHMTEVVRRCPHHERCSD-GDGLAPPQHLI

Rat                           RVRAMAIYKKSQHMTEVVRRCPHHERCSD-GDGLAPPQHLI

Pig                           RVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDGLAPPQHLI

Bovine                        RVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPPQHLI

Rabbit                        RVRAMAIYKKSQHMTEVVRRCPHHERCSD-SDGLAPPQHLI

Sheep                         RVRAMAIYKKLEHMTEVVRRSPHHERSSDYSDGLAPPQHLI

Cat                           CVRAMAIYKKSEFMTEVVRRCPHHERCPDSSDGLAPPQHLI

Chicken                       SLRAVAVYKKSEHVAEVVRRCPHHERCGGGTDGLAPAQHLI

Xenopus laevis                ILRATAVYKKSEHVAEVVKRCPHHERSVEPGEDAAPPSHLM

Zebrafish                     VVRATAIYKKSEHVAEVVRRCPHHERTPD-GDNLAPAGHLI

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 393 Cellular tumor antigen p53
DNA binding 102 – 292
Region 1 – 320 Interaction with CCAR2
Region 100 – 370 Interaction with HIPK1
Region 100 – 300 Required for interaction with ZNF385A
Region 113 – 236 Required for interaction with FBXO42
Region 116 – 292 Interaction with AXIN1
Binding site 176 – 176
Binding site 179 – 179
Modified residue 183 – 183 Phosphoserine; by AURKB
Mutagenesis 183 – 183 S -> A. Abolishes strongly phosphorylation.
Mutagenesis 183 – 183 S -> E. Inhibits slightly its transcriptional activity.
Helix 174 – 176



Literature citations
p53 gene mutations in Barrett's epithelium and esophageal cancer.
Casson A.G.; Mukhopadhyay T.; Cleary K.R.; Ro J.Y.; Levin B.; Roth J.A.;
Cancer Res. 51:4495-4499(1991)
Cited for: VARIANTS SPORADIC CANCERS LEU-152; ALA-155; HIS-175; PHE-176 AND HIS-273;
Frequent p53 mutations in head and neck cancer.
Somers K.D.; Merrick M.A.; Lopez M.E.; Incognito L.S.; Schechter G.L.; Casey G.;
Cancer Res. 52:5997-6000(1992)
Cited for: VARIANTS SPORADIC CANCERS PHE-176; PHE-242; CYS-245; LEU-248 AND HIS-273;
Molecular analysis of the TP53 gene in Barrett's adenocarcinoma.
Audrezet M.-P.; Robaszkiewicz M.; Mercier B.; Nousbaum J.-B.; Hardy E.; Bail J.-P.; Volant A.; Lozac'H P.; Gouerou H.; Ferec C.;
Hum. Mutat. 7:109-113(1996)
Cited for: VARIANTS SPORADIC CANCERS PHE-176; SER-245; TRP-248; TRP-282 AND GLN-286;
Detection of p53 gene mutations in oral squamous cell carcinomas of a black African population sample.
van Rensburg E.J.; Engelbrecht S.; van Heerden W.F.P.; Kotze M.J.; Raubenheimer E.J.;
Hum. Mutat. 11:39-44(1998)
Cited for: VARIANTS SER-152; ILE-169; PHE-176; THR-195; CYS-220; ILE-230; CYS-273 AND SER-278;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.