UniProtKB/Swiss-Prot P04637: Variant p.Gly279Glu

Cellular tumor antigen p53
Gene: TP53
Feedback?

Variant information Variant position:

279 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Glutamate (E) at position 279 (G279E, p.Gly279Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to medium size and acidic (E) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In sporadic cancers; somatic mutation. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs1064793881 [ dbSNP | Ensembl ]

Sequence information Variant position:

279 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

393 The length of the canonical sequence.
Location on the sequence:

DSSGNLLGRNSFEVRVCACP G RDRRTEEENLRKKGEPHHEL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPH--HEL

                              DSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPC--P

Rhesus macaque                DSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPC--H

Mouse                         DSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLC--P

Rat                           DSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHC--P

Pig                           DASGNLLGRNSFEVRVCACPGRDRRTEEENFLKKGQSC--P

Bovine                        DSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSC--P

Rabbit                        DSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPC--P

Sheep                         DSRGNLLGRSSFEVRVCACPGRDRRTEEENFRKKGQSC--P

Cat                           DSNGKLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPC--P

Chicken                       GPGGQLLGRRCFEVRVCACPGRDRKIEEENFRKRGGAG---

Xenopus laevis                TPQGLLLGRRCFEVRVCACPGRDRRTEEDNYTKKRGLK---

Zebrafish                     TQEGQLLGRRSFEVRVCACPGRDRKTEESNFKKDQETKTMA

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 393	Cellular tumor antigen p53
DNA binding	102 – 292
Region	1 – 320	Interaction with CCAR2
Region	100 – 370	Interaction with HIPK1
Region	100 – 300	Required for interaction with ZNF385A
Region	116 – 292	Interaction with AXIN1
Region	256 – 294	Interaction with E4F1
Region	273 – 280	Interaction with DNA
Modified residue	269 – 269	Phosphoserine; by AURKB
Modified residue	284 – 284	Phosphothreonine; by AURKB
Cross	291 – 291	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Cross	292 – 292	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Mutagenesis	269 – 269	S -> A. Abolishes phosphorylation.
Mutagenesis	269 – 269	S -> E. Inhibits strongly its transcriptional activity.
Mutagenesis	284 – 284	T -> E. Inhibits strongly its transcriptional activity.
Helix	278 – 287

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.