Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P01270: Variant p.Cys18Arg

Parathyroid hormone
Gene: PTH
Feedback?
Variant information Variant position: help 18 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Arginine (R) at position 18 (C18R, p.Cys18Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In FIH1; dominant form; leads to inefficient processing of the precursor; the expressed mutant hormone is trapped intracellularly in the endoplasmic reticulum resulting in apoptosis; mutant protein-expressing cells also show marked up-regulation of the endoplasmic reticulum stress-responsive hormones HSPA5 and EIF2AK3 and the proapoptotic transcription factor DDIT3. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 18 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 115 The length of the canonical sequence.
Location on the sequence: help MIPAKDMAKVMIVMLAI C FLTKSDGKSVKKRSVSEIQL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQL

                              MMSAKDMVKVMIVMFAICFLAKSDGKPVKKRSVSEIQF

Rat                           MMSASTMAKVMILMLAVCLLTQADGKPVKKRAVSEIQL

Pig                           MMSAKDTVKVMVVMLAICFLARSDGKPIKKRSVSEIQL

Bovine                        MMSAKDMVKVMIVMLAICFLARSDGKSVKKRAVSEIQF

Cat                           MMSAKDMVKVMVVMFAICFLAKSDGKPVKKRSVSEIQF

Horse                         MMSAKNMVKVMIVMFAIFLLAKSDGKPVRKRSVSEIQL

Chicken                       MTSTKNLAKAIVILYAICFFTNSDGRPMMKRSVSEMQL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Signal peptide 1 – 25
Mutagenesis 16 – 16 A -> R. Abolishes processing of the precursor; when associated with variant R-18.



Literature citations
Inefficient membrane targeting, translocation, and proteolytic processing by signal peptidase of a mutant preproparathyroid hormone protein.
Karaplis A.C.; Lim S.-K.; Baba H.; Arnold A.; Kronenberg H.M.;
J. Biol. Chem. 270:1629-1635(1995)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-31; MUTAGENESIS OF ALA-16; VARIANT ARG-18; Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism.
Arnold A.; Horst S.A.; Gardella T.J.; Baba H.; Levine M.A.; Kronenberg H.M.;
J. Clin. Invest. 86:1084-1087(1990)
Cited for: VARIANT FIH1 ARG-18; Signal sequence mutation in autosomal dominant form of hypoparathyroidism induces apoptosis that is corrected by a chemical chaperone.
Datta R.; Waheed A.; Shah G.N.; Sly W.S.;
Proc. Natl. Acad. Sci. U.S.A. 104:19989-19994(2007)
Cited for: CHARACTERIZATION OF VARIANT FIH1 ARG-18;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.