UniProtKB/Swiss-Prot Q06187 : Variant p.Lys12Arg
Tyrosine-protein kinase BTK
Feedback ?
Variant information
Variant position:
12
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
Disclaimer : Variants classification is intended for research purposes only, not for clinical and diagnostic use . The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant. ]
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
12 (K12R, p.Lys12Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution).following page
Variant description:
Any additional useful information about the variant.
Sequence information
Variant position:
12
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
659
The length of the canonical sequence.
Location on the sequence:
K RSQQKKKTSPLNFKKRLFLL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human MAAVILESIFLK RSQQKKKTSPLNFKKRLFLL
Mouse MAAVILESIFLK RSQQKKKTSPLNFKKRLFLL
Chicken MASIILESIFLK RSQQKKKTSPLNFKKRLFLL
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Initiator methionine
1 – 1 Removed
Chain
2 – 659 Tyrosine-protein kinase BTK
Domain
3 – 133 PH
Region
12 – 24 Inositol-(1,3,4,5)-tetrakisphosphate 1-binding
Binding site
26 – 26
Binding site
28 – 28
Modified residue
2 – 2 N-acetylalanine
Modified residue
21 – 21 Phosphoserine
Alternative sequence
1 – 1 M -> MASWSIQQMVIGCPLCGRHCSGGEHTGELQKEEAM. In isoform BTK-C.
Beta strand
5 – 13
Literature citations
Identification of Bruton's tyrosine kinase (Btk) gene mutations and characterization of the derived proteins in 35 X-linked agammaglobulinemia families: a nationwide study of Btk deficiency in Japan.
Hashimoto S.; Tsukada S.; Matsushita M.; Miyawaki T.; Niida Y.; Yachie A.; Kobayashi S.; Iwata T.; Hayakawa H.; Matsuoka H.; Tsuge I.; Yamadori T.; Kunikata T.; Arai S.; Yoshizaki K.; Taniguchi N.; Kishimoto T.;
Blood 88:561-573(1996)
Cited for: VARIANTS XLA ARG-12; PRO-28; GLU-302; TRP-502; HIS-521; TYR-633 AND SER-644;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.
