UniProtKB/Swiss-Prot P07741: Variant p.Met136Thr

• Variant information
• Sequence information
• Literature citations
• All

Variant information

Variant position: 136 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: LP/P [Disclaimer: Variants classification is intended for research purposes only, not for clinical and diagnostic use. The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant.] The variants are classified into three categories: LP/P, LB/B and US.

• LP/P: likely pathogenic or pathogenic.
• LB/B: likely benign or benign.
• US: uncertain significance

Residue change: From Methionine (M) to Threonine (T) at position 136 (M136T, p.Met136Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: Change from medium size and hydrophobic (M) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

• Lowest score: -4 (low probability of substitution).
• Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description: In APRTD; Japanese type; allele APRT*J; most common mutation. Any additional useful information about the variant.
Other resources: Links to websites of interest for the variant.

• Variant rs28999113 [ dbSNP | Ensembl ]

Sequence information

Variant position: 136 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 180 The length of the canonical sequence.
Location on the sequence: ALEPGQRVVVVDDLLATGGT M NAACELLGRLQAEVLECVSL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

• Type: the type of sequence feature.
• Positions: endpoints of the sequence feature.
• Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 180	Adenine phosphoribosyltransferase
Modified residue	135 – 135	Phosphothreonine
Alternative sequence	134 – 180	GTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE -> V. In isoform 2.
Helix	134 – 145

Literature citations

Human adenine phosphoribosyltransferase. Identification of allelic mutations at the nucleotide level as a cause of complete deficiency of the enzyme.
Hidaka Y.; Palella T.D.; O'Toole T.E.; Tarle S.A.; Kelley W.N.;
J. Clin. Invest. 80:1409-1415(1987)
Cited for: VARIANT APRTD THR-136; Human adenine phosphoribosyltransferase deficiency. Demonstration of a single mutant allele common to the Japanese.
Hidaka Y.; Tarle S.A.; Fujimori S.; Kamatani N.; Kelley W.N.;
J. Clin. Invest. 81:945-950(1988)
Cited for: VARIANTS APRTD THR-136 AND PHE-173 DEL; Only three mutations account for almost all defective alleles causing adenine phosphoribosyltransferase deficiency in Japanese patients.
Kamatani N.; Hakoda M.; Otsuka S.; Yoshikawa H.; Kashiwazaki S.;
J. Clin. Invest. 90:130-135(1992)
Cited for: VARIANT APRTD THR-136; A Japanese boy with adenine phosphoribosyltransferase (APRT) deficiency caused by compound heterozygosity including a novel missense mutation in APRT gene.
Nozue H.; Kamoda T.; Saitoh H.; Ichikawa K.; Taniguchi A.;
Acta Paediatr. 100:E285-E288(2011)
Cited for: VARIANTS APRTD PRO-33 AND THR-136;