Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P01009: Variant p.Met382Arg

Alpha-1-antitrypsin
Gene: SERPINA1
Feedback?
Variant information Variant position: help 382 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Methionine (M) to Arginine (R) at position 382 (M382R, p.Met382Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (M) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help The sequence shown is that of the M1V allele which is the most common form of PI (44 to 49%). Other frequent alleles are: M1A 20 to 23%; M2 10 to 11%; M3 14 to 19%. Additional information on the polymorphism described.
Variant description: help In Pittsburgh; has antithrombin activity; inhibits factor VIIa activity; causes fatal bleeding diathesis. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 382 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 418 The length of the canonical sequence.
Location on the sequence: help LTIDEKGTEAAGAMFLEAIP M SIPPEVKFNKPFVFLMIEQN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 25 – 418 Alpha-1-antitrypsin
Peptide 375 – 418 Short peptide from AAT
Region 368 – 392 RCL
Site 382 – 383 Reactive bond
Modified residue 383 – 383 Phosphoserine
Alternative sequence 307 – 418 Missing. In isoform 3.
Alternative sequence 356 – 418 AVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK -> VRSP. In isoform 2.
Mutagenesis 382 – 382 M -> V. Oxidation-resistant inhibitor of therapeutic importance.
Beta strand 379 – 383



Literature citations
Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases.
Dementiev A.; Simonovic M.; Volz K.; Gettins P.G.;
J. Biol. Chem. 278:37881-37887(2003)
Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 26-418 OF VARIANT PITTSBURGH ARG-382; Mutation of antitrypsin to antithrombin. Alpha 1-antitrypsin Pittsburgh (358 Met leads to Arg), a fatal bleeding disorder.
Owen M.C.; Brennan S.O.; Lewis J.H.; Carrell R.W.;
N. Engl. J. Med. 309:694-698(1983)
Cited for: VARIANT PITTSBURGH ARG-382; The M358R variant of alpha(1)-proteinase inhibitor inhibits coagulation factor VIIa.
Sheffield W.P.; Bhakta V.;
Biochem. Biophys. Res. Commun. 470:710-713(2016)
Cited for: CHARACTERIZATION OF VARIANT PITTSBURGH ARG-382;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.