UniProtKB/Swiss-Prot P05155: Variant p.Val480Met

Plasma protease C1 inhibitor
Gene: SERPING1
Feedback?

Variant information Variant position:

480 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Methionine (M) at position 480 (V480M, p.Val480Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Chymotrypsin uses Ala-465 as its reactive site in normal plasma protease C1 inhibitor, and His-466 as its reactive site in the variant His-466. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs4926 [ dbSNP | Ensembl ]

Sequence information Variant position:

480 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

500 The length of the canonical sequence.
Location on the sequence:

SAISVARTLLVFEVQQPFLF V LWDQQHKFPVFMGRVYDPRA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SAISVARTLLVFEVQQPFLFVLWDQQHKFPVFMGRVYDPRA

Mouse                         SAISFGRSLPIFEVQRPFLFLLWDQQHRFPVFMGRVYDPRG

Rat                           STISVARNLLIFEVQQPFLFLLWDQRHKFPVFMGRVYDPRA

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	23 – 500	Plasma protease C1 inhibitor
Beta strand	477 – 483

Literature citations
Cloning of human full-length CDSs in BD Creator(TM) system donor vector.
Kalnine N.; Chen X.; Rolfs A.; Halleck A.; Hines L.; Eisenstein S.; Koundinya M.; Raphael J.; Moreira D.; Kelley T.; LaBaer J.; Lin Y.; Phelan M.; Farmer A.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT MET-480; Submission
Totoki Y.; Toyoda A.; Takeda T.; Sakaki Y.; Tanaka A.; Yokoyama S.; Ohara O.; Nagase T.; Kikuno R.F.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT MET-480; Submission
SeattleSNPs variation discovery resource;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT MET-480; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT MET-480; Normal C1 inhibitor mRNA expression level in type I hereditary angioedema patients: newly found C1 inhibitor gene mutations.
Kang H.-R.; Yim E.-Y.; Oh S.-Y.; Chang Y.-S.; Kim Y.-K.; Cho S.-H.; Min K.-U.; Kim Y.-Y.;
Allergy 61:260-264(2006)
Cited for: VARIANT HAE1 ARG-345; VARIANTS ALA-56 AND MET-480; Mutational spectrum and geno-phenotype correlation in Chinese families with Hereditary Angioedema.
Xu Y.Y.; Zhi Y.X.; Yin J.; Wang L.L.; Wen L.P.; Gu J.Q.; Guan K.; Craig T.; Zhang H.Y.;
Allergy 67:1430-1436(2012)
Cited for: VARIANTS HAE1 ALA-118; CYS-154; PHE-170; ARG-184; PRO-230; LYS-232; ASN-272 DEL; ARG-299; GLN-430; THR-441; PRO-447; SER-466; CYS-466; LEU-466; GLY-473 AND GLY-497; VARIANTS ALA-56 AND MET-480;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.