Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P05543: Variant p.Asp191Asn

Thyroxine-binding globulin
Gene: SERPINA7
Feedback?
Variant information Variant position: help 191 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Aspartate (D) to Asparagine (N) at position 191 (D191N, p.Asp191Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (D) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Genetic variants in SERPINA7 influence the serum levels of thyroxine-binding globulin and define the thyroxine-binding globulin quantitative trait locus (TBGQTL) [MIM:300932]. Individuals with low or high serum levels of thyroxine-binding globulin show, respectively, reduced or elevated protein-bound iodine but are euthyroid and do not manifest major metabolic alterations (PubMed:1294376, PubMed:1515456, PubMed:1901689, PubMed:1906047, PubMed:2155256, PubMed:2501669). Two qualitative TBG variants occur in particular populations. TBG-A is found in 40% of Australian aborigines, it has reduced affinity for thyroxine and triiodothyroxine and increased susceptibility to inactivation by heat or acid (PubMed:2495303). TBG-S ('s' for slow shift on isoelectic focusing) is found in blacks, Eskimos, Melanesians, Polynesians and Indonesians, but not in Caucasians; TBG-S is slightly more thermolabile (PubMed:2115061). Additional information on the polymorphism described.
Variant description: help TBG-S/Slow. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 191 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 415 The length of the canonical sequence.
Location on the sequence: help QEINSHVEMQTKGKVVGLIQ D LKPNTIMVLVNYIHFKAQWA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         QEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQWA

Chimpanzee                    QEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQWA

Mouse                         HKINSYVEKQTKGKIVGLIQGLKLNIIMILVNYIHFRAQWA

Rat                           HEINSYVEKQTKGKIVGLIQDLKLNIIMILVNYIHFKAQWA

Pig                           QELNSHVERQTKGKIVGLIPDLKPNTIMVLVNYICFKAQWA

Bovine                        QEINSHVEKQTKGKIVGLIQDLKPNTITVLVNYLCFKAQWA

Sheep                         QEINSHVERQTKGKIVGLIQDLKPNTITVLVNYLCFKAQWA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 21 – 415 Thyroxine-binding globulin



Literature citations
Molecular basis for the properties of the thyroxine-binding globulin-slow variant in American blacks.
Waltz M.R.; Pullman T.N.; Takeda K.; Sobieszczyk P.; Refetoff S.;
J. Endocrinol. Invest. 13:343-349(1990)
Cited for: VARIANT TBG-S ASN-191;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.