UniProtKB/Swiss-Prot P11168: Variant p.Pro68Leu

• Variant information
• Sequence information
• Literature citations
• All

Variant information

Variant position: 68 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: LB/B The variants are classified into three categories: LP/P, LB/B and US.

• LP/P: likely pathogenic or pathogenic.
• LB/B: likely benign or benign.
• US: uncertain significance

Residue change: From Proline (P) to Leucine (L) at position 68 (P68L, p.Pro68Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

• Lowest score: -4 (low probability of substitution).
• Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources: Links to websites of interest for the variant.

• Variant rs7637863 [ dbSNP | Ensembl ]

Sequence information

Variant position: 68 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 524 The length of the canonical sequence.
Location on the sequence: VPLDDRKAINNYVINSTDEL P TISYSMNPKPTPWAEEETVA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

• Type: the type of sequence feature.
• Positions: endpoints of the sequence feature.
• Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 524	Solute carrier family 2, facilitated glucose transporter member 2
Topological domain	32 – 98	Extracellular
Glycosylation	62 – 62	N-linked (GlcNAc...) asparagine
Alternative sequence	1 – 123	MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGDTLG -> MHLN. In isoform 2.

Literature citations

Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein.
Fukumoto H.; Seino S.; Imura H.; Sieno Y.; Eddy R.L.; Fukushima Y.; Byers M.G.; Shows T.B.; Bell G.I.;
Proc. Natl. Acad. Sci. U.S.A. 85:5434-5438(1988)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); FUNCTION; TISSUE SPECIFICITY; VARIANT LEU-68; Sequence variations of the pancreatic islet/liver glucose transporter (GLUT2) gene in Japanese subjects with noninsulin dependent diabetes mellitus.
Matsubara A.; Tanizawa Y.; Matsutani A.; Kaneko T.; Kaku K.;
J. Clin. Endocrinol. Metab. 80:3131-3135(1995)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 29-100 (ISOFORM 1); VARIANTS LEU-68 AND ILE-110;