Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P22304: Variant p.Arg468Trp

Iduronate 2-sulfatase
Gene: IDS
Feedback?
Variant information Variant position: help 468 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 468 (R468W, p.Arg468Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MPS2; mild to severe forms. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 468 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 550 The length of the canonical sequence.
Location on the sequence: help EEDPYLPGNPRELIAYSQYP R PSDIPQWNSDKPSLKDIKIM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKPSLKDIKIM

Mouse                         EEEPDLFGNPRELIAYSQYPRPADFPQWNSDKPSLNDIKVM

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 456 – 550 Iduronate 2-sulfatase 14 kDa chain
Alternative sequence 313 – 550 Missing. In isoform 3.
Alternative sequence 344 – 550 Missing. In isoform 2.
Beta strand 462 – 469



Literature citations
Mutation R468W of the iduronate-2-sulfatase gene in mild Hunter syndrome (mucopolysaccharidosis type II) confirmed by in vitro mutagenesis and expression.
Crotti P.L.; Bunge S.; Anderson R.A.; Whitley C.B.;
Hum. Mol. Genet. 1:755-757(1992)
Cited for: VARIANT MPS2 TRP-468;
Mutations of the iduronate-2-sulfatase gene in 12 Polish patients with mucopolysaccharidosis type II (Hunter syndrome).
Popowska E.; Rathmann M.; Tylki-Szymanska A.; Bunge S.; Steglich C.; Schwinger E.; Gal A.;
Hum. Mutat. 5:97-100(1995)
Cited for: VARIANTS MPS2 LEU-86; ASN-87; PRO-92; ASN-135; CYS-345 AND TRP-468;
Mutation analysis in 20 patients with Hunter disease.
Goldenfum S.L.; Young E.; Michelakakis H.; Tsagarakis S.; Winchester B.;
Hum. Mutat. 7:76-78(1996)
Cited for: VARIANTS MPS2 ASP-63; ARG-86; GLY-95; PRO-205; TRP-468 AND GLN-468;
Molecular analysis in 23 Hunter disease families.
Lissens W.; Seneca S.; Liebaers I.;
J. Inherit. Metab. Dis. 20:453-456(1997)
Cited for: VARIANTS MPS2 PHE-73; THR-118 DEL; HIS-121; TRP-132; ARG-336; LYS-341; GLN-347; TRP-468; GLN-468; LYS-521 AND VAL-521;
Identification of iduronate sulfatase gene alterations in 70 unrelated Hunter patients.
Froissart R.; Maire I.; Millat G.; Cudry S.; Birot A.-M.; Bonnet V.; Bouton O.; Bozon D.;
Clin. Genet. 53:362-368(1998)
Cited for: VARIANTS MPS2 ASN-71; SER-85; THR-85; LEU-86; GLY-88; HIS-88; PHE-89; SER-108; SER-117 DEL; ILE-118; ARG-121; ASP-138; HIS-148; ARG-229; LEU-333; ASN-334; ARG-335; GLU-336; ARG-339; ARG-403; LEU-467; GLN-468; TRP-468; ARG-480; GLN-480; LEU-480 AND SER-490;
Mutation analysis in the iduronate-2-sulphatase gene in 43 Japanese patients with mucopolysaccharidosis type II (Hunter disease).
Isogai K.; Sukegawa K.; Tomatsu S.; Fukao T.; Song X.-Q.; Yamada Y.; Fukuda S.; Orii T.; Kondo N.;
J. Inherit. Metab. Dis. 21:60-70(1998)
Cited for: VARIANTS MPS2 PRO-48; THR-85; LEU-86; PRO-182; SER-196; ASP-225; MET-227; ASN-308; PRO-314; LEU-333; ARG-337; ILE-349; GLN-468; LEU-468 AND TRP-468;
Mutation analysis of iduronate-2-sulphatase gene in 24 patients with Hunter syndrome: characterisation of 6 novel mutations.
Hartog C.; Fryer A.; Upadhyaya M.;
Hum. Mutat. 14:87-87(1999)
Cited for: VARIANTS MPS2 ASN-264; PRO-465 AND TRP-468;
Molecular basis of iduronate-2-sulphatase gene mutations in patients with mucopolysaccharidosis type II (Hunter syndrome).
Li P.; Bellows A.B.; Thompson J.N.;
J. Med. Genet. 36:21-27(1999)
Cited for: VARIANTS MPS2 ARG-71; GLU-82; THR-85; CYS-88; ARG-95 DEL; GLN-468; TRP-468 AND VAL-521;
Molecular basis of mucopolysaccharidosis type II in Portugal: identification of four novel mutations.
Moreira da Silva I.; Froissart R.; Marques dos Santos H.; Caseiro C.; Maire I.; Bozon D.;
Clin. Genet. 60:316-318(2001)
Cited for: VARIANTS MPS2 CYS-88; THR-95; ILE-181; ARG-422; LEU-467; GLN-468 AND TRP-468;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.