Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P60484: Variant p.Arg130Gln

Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Gene: PTEN
Feedback?
Variant information Variant position: help 130 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Glutamine (Q) at position 130 (R130Q, p.Arg130Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CWS1; loss of phosphatase activity towards Ins(1,3,4,5)P4; retains ability to bind phospholipid membranes. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 130 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 403 The length of the canonical sequence.
Location on the sequence: help QWLSEDDNHVAAIHCKAGKG R TGVMICAYLLHRGKFLKAQE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         QWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQE

                              QWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQE

Mouse                         QWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQE

Rat                           QWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQE

Xenopus laevis                QLLSENEN-VAAIHCKAGKGRTGVMICAYLLHRGKFPRAQE

Caenorhabditis elegans        EWLEADDKHVIAVHCKAGKGRTGVMICALLIYINFYPSPRQ

Slime mold                    AWMKEDSKNIAVIHCKAGKGRTGLMICCWLMYCGMWKNTED

Fission yeast                 ALFQTQPLLTLVVHCKAGKGRTGTVICSYLVAFGG-LTAKQ

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 403 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Domain 14 – 185 Phosphatase tensin-type
Active site 124 – 124 Phosphocysteine intermediate
Mutagenesis 124 – 124 C -> A. Loss of protein phosphatase activity. Unable to inhibit focal adhesion formation.
Mutagenesis 125 – 125 K -> M. Reduced phosphatase activity towards PtdIns(3,4,5)P3, PtdIns(3,4)P2 and PtdIns(3)P.
Mutagenesis 126 – 126 A -> P. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3 and PtdIns(3,4)P2.
Mutagenesis 126 – 126 A -> S. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3 and PtdIns(3,4)P2.
Mutagenesis 126 – 126 A -> V. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3 and PtdIns(3,4)P2.
Mutagenesis 128 – 128 K -> M. 85% reduction in phosphatase activity towards PtdIns(3,4,5)P3.
Mutagenesis 128 – 128 K -> R. Does not reduce phosphatase activity towards PtdIns(3,4,5)P3.
Mutagenesis 130 – 130 R -> M. Does not affect the ability to inhibit AKT/PKB activation.
Helix 129 – 142



Literature citations
Variant manifestation of Cowden disease in Japan: hamartomatous polyposis of the digestive tract with mutation of the PTEN gene.
Kurose K.; Araki T.; Matsunaka T.; Takada Y.; Emi M.;
Am. J. Hum. Genet. 64:308-310(1999)
Cited for: VARIANT CWS1 GLN-130;
Functional evaluation of PTEN missense mutations using in vitro phosphoinositide phosphatase assay.
Han S.-Y.; Kato H.; Kato S.; Suzuki T.; Shibata H.; Ishii S.; Shiiba K.; Matsuno S.; Kanamaru R.; Ishioka C.;
Cancer Res. 60:3147-3151(2000)
Cited for: CHARACTERIZATION OF VARIANTS ASN-10; CYS-16; GLU-20; SER-27; ARG-61; HIS-68; ARG-112; PRO-121; ARG-129; GLY-130; ILE-133; LEU-134; ARG-165; ASN-170; CYS-173; HIS-173; PRO-173; ASN-174; PHE-227; CYS-251; GLN-345; GLY-369 AND ILE-401; CHARACTERIZATION OF VARIANTS CWS1 TYR-71; TYR-93; PHE-105; TYR-107; PRO-112; ARG-124; GLU-129; LEU-130; GLN-130; TYR-136; CYS-155; ARG-170; GLU-289; GLY-331; VAL-341; ASN-342; GLU-343 AND LEU-347;
Predicting PTEN mutations: an evaluation of Cowden syndrome and Bannayan-Riley-Ruvalcaba syndrome clinical features.
Pilarski R.; Stephens J.A.; Noss R.; Fisher J.L.; Prior T.W.;
J. Med. Genet. 48:505-512(2011)
Cited for: VARIANTS CWS1 SER-15; ASP-34; ARG-36; ARG-61; HIS-68; GLU-129; GLY-130; LEU-130; GLN-130; TYR-136; ARG-165; ARG-170; GLY-252 AND LEU-347;
Second malignant neoplasms in patients with Cowden syndrome with underlying germline PTEN mutations.
Ngeow J.; Stanuch K.; Mester J.L.; Barnholtz-Sloan J.S.; Eng C.;
J. Clin. Oncol. 32:1818-1824(2014)
Cited for: VARIANTS CWS1 ARG-61; TYR-93; GLY-130; GLN-130; LEU-130 AND CYS-173;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.