Home  |  Contact

UniProtKB/Swiss-Prot P60174: Variant p.Ile208Val

Triosephosphate isomerase
Gene: TPI1
Chromosomal location: 12p13
Variant information

Variant position:  208
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Isoleucine (I) to Valine (V) at position 208 (I208V, p.Ile208Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Triosephosphate isomerase deficiency (TPID) [MIM:615512]: An autosomal recessive multisystem disorder characterized by congenital hemolytic anemia, progressive neuromuscular dysfunction, susceptibility to bacterial infection, and cardiomyopathy. {ECO:0000269|PubMed:2876430, ECO:0000269|PubMed:8503454, ECO:0000269|PubMed:8571957, ECO:0000269|PubMed:9338582, ECO:0000269|Ref.37}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In TPID.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  208
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  286
The length of the canonical sequence.

Location on the sequence:   IADNVKDWSKVVLAYEPVWA  I GTGKTATPQQAQEVHEKLRG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRG

Gorilla                       ITD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

                              IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Rhesus macaque                IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Chimpanzee                    IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Mouse                         IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Rat                           IAD-NVKDWCKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Pig                           IAD-NVKDWNKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Bovine                        IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Rabbit                        IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Chicken                       IAD-NVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR

Xenopus laevis                IAD-NVKDWSKVVLAYEPVWAIGTGKTATPEQAQEVHKKLR

Xenopus tropicalis            IAD-NVKDWSKVVLAYEPVWAIGTGKTATPEQAQEVHKKLR

Caenorhabditis elegans        IVD-KGVSWENIVIAYEPVWAIGTGKTASGEQAQEVHEWIR

Drosophila                    YAQ-KIKDWKNVVVAYEPVWAIGTGQTATPDQAQEVHAFLR

Slime mold                    FASFTPEEWSKIVIAYEPVWAIGTGAVATPQEAQDTHVFIR

Baker's yeast                 VLE-EVKDWTNVVVAYEPVWAIGTGLAATPEDAQDIHASIR

Fission yeast                 IAD-KVQNWSKIVIAYEPVWAIGTGKTATPEQAQEVHAEIR

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 286 Triosephosphate isomerase
Active site 203 – 203 Proton acceptor
Modified residue 193 – 193 N6-acetyllysine; alternate
Modified residue 193 – 193 N6-succinyllysine; alternate
Modified residue 196 – 196 Phosphoserine
Modified residue 210 – 210 Phosphothreonine
Turn 208 – 210


Literature citations

Evidence for founder effect of the Glu104Asp substitution and identification of new mutations in triosephosphate isomerase deficiency.
Arya R.; Lalloz M.R.A.; Bellingham A.J.; Layton D.M.;
Hum. Mutat. 10:290-294(1997)
Cited for: VARIANTS TPID TYR-79; ASP-142 AND VAL-208;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.