UniProtKB/Swiss-Prot P02766: Variant p.Gly121Ser

Transthyretin
Gene: TTR
Feedback?

Variant information Variant position:

121 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Serine (S) at position 121 (G121S, p.Gly121Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs755337715 [ dbSNP | Ensembl ]

Sequence information Variant position:

121 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

147 The length of the canonical sequence.
Location on the sequence:

ALGISPFHEHAEVVFTANDS G PRRYTIAALLSPYSYSTTAV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAV

Chimpanzee                    ALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAV

Mouse                         TLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAV

Rat                           ALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAV

Pig                           ALGISPFHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTAL

Bovine                        SLGISPFHEFAEVVFTANDSGPRHYTIAALLSPYSYSTTAL

Rabbit                        ALGISPFHEYAEVVFTANDSGHRSYTIAALLSPFSYSTTAV

Sheep                         SLGISPFHEYAEVVFTANDSGLRHYTIAALLSPYSYSTTAL

Chicken                       GLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAV

Xenopus laevis                KLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAI

Xenopus tropicalis            KLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAV

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	21 – 147	Transthyretin
Binding site	137 – 137
Glycosylation	118 – 118	N-linked (GlcNAc...) asparagine
Mutagenesis	107 – 107	F -> M. Loss of tetramerization; when associated with M-130.
Mutagenesis	130 – 130	L -> M. Loss of tetramerization; when associated with M-107.
Beta strand	120 – 122

Literature citations
A new nonamyloid transthyretin variant, G101S, detected by electrospray ionization/mass spectrometry.
Kishikawa M.; Nakanishi T.; Miyazaki A.; Hatanaka M.; Shimizu A.; Tamoto S.; Ohsawa N.; Hayashi H.; Kanai M.;
Hum. Mutat. 12:363-363(1998)
Cited for: VARIANT SER-121; IDENTIFICATION BY MASS SPECTROMETRY; Genetic microheterogeneity of human transthyretin detected by IEF.
Altland K.; Benson M.D.; Costello C.E.; Ferlini A.; Hazenberg B.P.C.; Hund E.; Kristen A.V.; Linke R.P.; Merlini G.; Salvi F.; Saraiva M.J.; Singer R.; Skinner M.; Winter P.;
Electrophoresis 28:2053-2064(2007)
Cited for: VARIANTS AMYL-TTR PRO-32; ILE-40; SER-44; ALA-50; MET-50; LEU-53; VAL-53; PRO-56; THR-65; ALA-67; ALA-69; ILE-69; ALA-80; LEU-84; LEU-88; ALA-91; TYR-97; PHE-98; SER-104; ASN-104; THR-104; ALA-114; GLY-117; ASN-126; MET-127; VAL-127; MET-131 AND ILE-142; VARIANTS ILE-33; SER-121 AND THR-129; VARIANT CHICAGO MET-139;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.