Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P49747: Variant p.Asp342Tyr

Cartilage oligomeric matrix protein
Gene: COMP
Feedback?
Variant information Variant position: help 342 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Aspartate (D) to Tyrosine (Y) at position 342 (D342Y, p.Asp342Tyr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (D) to large size and aromatic (Y) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In EDM1; Fairbank type. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 342 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 757 The length of the canonical sequence.
Location on the sequence: help PNEKDNCPLVRNPDQRNTDE D KWGDACDNCRSQKNDDQKDT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         PNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDT

Mouse                         PNEQDNCPLVRNPDQRNSDSDKWGDACDNCRSKKNDDQKDT

Rat                           PNEQDNCPLVRNPDQRNSDKDKWGDACDNCRSQKNDDQKDT

Bovine                        LNEKDNCPLVRNPDQRNTDGDKWGDACDNCRSQKNDDQKDT
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 21 – 757 Cartilage oligomeric matrix protein
Repeat 337 – 359 TSP type-3 3
Region 298 – 503 Disordered
Compositional bias 335 – 383 Basic and acidic residues
Disulfide bond 328 – 348
Beta strand 342 – 344



Literature citations
Pseudoachondroplasia and multiple epiphyseal dysplasia due to mutations in the cartilage oligomeric matrix protein gene.
Briggs M.D.; Hoffman S.M.G.; King L.M.; Olsen A.S.; Mohrenweiser H.; Leroy J.G.; Mortier G.R.; Rimoin D.L.; Lachman R.S.; Gaines E.S.; Cekleniak J.A.; Knowlton R.G.; Cohn D.H.;
Nat. Genet. 10:330-336(1995)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 326-344; VARIANT EDM1 TYR-342; VARIANT PSACH ARG-328; Identification of five novel mutations in cartilage oligomeric matrix protein gene in pseudoachondroplasia and multiple epiphyseal dysplasia.
Loughlin J.; Irven C.; Mustafa Z.; Briggs M.D.; Carr A.; Lynch S.-A.; Knowlton R.G.; Cohn D.H.; Sykes B.;
Hum. Mutat. Suppl. 1:S10-S17(1998)
Cited for: VARIANTS PSACH ARG-328; ASP-372 DEL; 391-PRO--ASP-394 DELINS VAL; ARG-440; SER-459 DEL; TYR-468; ASP-469 DEL AND TYR-472; VARIANTS EDM1 TYR-342; TYR-361; 367-ARG-GLY-368 DEL AND TYR-408;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.