Home  |  Contact

UniProtKB/Swiss-Prot P49638: Variant p.Arg192His

Alpha-tocopherol transfer protein
Gene: TTPA
Variant information

Variant position:  192
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Histidine (H) at position 192 (R192H, p.Arg192His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Ataxia with isolated vitamin E deficiency (AVED) [MIM:277460]: An autosomal recessive disease characterized by undetectable or markedly reduced plasma levels of vitamin E, spinocerebellar degeneration, ataxia, areflexia and proprioception loss. {ECO:0000269|PubMed:15065857, ECO:0000269|PubMed:15300460, ECO:0000269|PubMed:7566022, ECO:0000269|PubMed:8602747, ECO:0000269|PubMed:9463307}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In AVED.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  192
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  278
The length of the canonical sequence.

Location on the sequence:   TPSVAKKIAAVLTDSFPLKV  R GIHLINEPVIFHAVFSMIKP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKP

Mouse                         TPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKP

Rat                           TPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKP

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 278 Alpha-tocopherol transfer protein
Domain 88 – 253 CRAL-TRIO
Binding site 190 – 190 Phosphatidylinositol lipid headgroup
Binding site 192 – 192 Phosphatidylinositol lipid headgroup
Beta strand 191 – 198


Literature citations

Human alpha-tocopherol transfer protein: gene structure and mutations in familial vitamin E deficiency.
Hentati A.; Deng H.-X.; Hung W.-Y.; Nayer M.; Ahmed M.S.; He X.; Tim R.; Stumpf D.A.; Siddique T.;
Ann. Neurol. 39:295-300(1996)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT AVED HIS-192;

Molecular determinants of heritable vitamin E deficiency.
Morley S.; Panagabko C.; Shineman D.; Mani B.; Stocker A.; Atkinson J.; Manor D.;
Biochemistry 43:4143-4149(2004)
Cited for: CHARACTERIZATION OF VARIANTS AVED TRP-59; GLN-101; THR-120; LYS-141; HIS-192 AND TRP-221;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.