Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P21217: Variant p.Arg68Trp

3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3
Gene: FUT3
Feedback?
Variant information Variant position: help 68 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 68 (R68W, p.Arg68Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Genetic variations in FUT3 define the Lewis blood group system (LE) [MIM:618983]. FUT3 catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. Variations in this gene are responsible for the majority of Lewis antigen-negative phenotypes (Le(-)). Additional information on the polymorphism described.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 68 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 361 The length of the canonical sequence.
Location on the sequence: help PSGSSRQDTTPTRPTLLILL R TWPFHIPVALSRCSEMVPGT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PSGSSRQDTTPTRPTLLILLRTWPFHIPVALSRCSEMVPGT

Chimpanzee                    PSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGA

Bovine                        PSQAT--EGSSAHLPLRVLLWTWPFNQPVALSRCSELWPGT

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 361 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3
Topological domain 35 – 361 Lumenal



Literature citations
A cloned human cDNA determines expression of a mouse stage-specific embryonic antigen and the Lewis blood group alpha(1,3/1,4)fucosyltransferase.
Kukowska-Latallo J.F.; Larsen R.D.; Nair R.P.; Lowe J.B.;
Genes Dev. 4:1288-1303(1990)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS TRP-68 AND THR-105; CATALYTIC ACTIVITY; FUNCTION; TOPOLOGY; Alpha (1,3/1,4)fucosyltransferase (FucT-III) gene is inactivated by a single amino acid substitution in Lewis histo-blood type negative individuals.
Nishihara S.; Yazawa S.; Iwasaki H.; Nakazato M.; Kudo T.; Ando T.; Narimatsu H.;
Biochem. Biophys. Res. Commun. 196:624-631(1993)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS LE(-) ARG-20; SER-170 AND ALA-336; VARIANTS TRP-68 AND THR-105; Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms.
Cameron H.S.; Szczepaniak D.; Weston B.W.;
J. Biol. Chem. 270:20112-20122(1995)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS TRP-68 AND THR-105; TISSUE SPECIFICITY; Isolation and expression of human alpha (1,3/1,4) fucosyltransferase.
Rahim I.; Schmidt L.R.; Wahl D.; Drayson E.; Maslanik W.; Stranahan P.L.; Pettijohn D.E.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS TRP-68 AND THR-105; Submission
SeattleSNPs variation discovery resource;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS LE(-) ARG-20; ASN-162; SER-170; ARG-223 AND MET-270; VARIANTS SER-5; CYS-160; MET-325 AND GLN-327; VARIANTS TRP-68 AND THR-105; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANTS TRP-68 AND THR-105;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.