Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P30566: Variant p.Arg426His

Adenylosuccinate lyase
Gene: ADSL
Feedback?
Variant information Variant position: help 426 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Histidine (H) at position 426 (R426H, p.Arg426His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In ADSLD; severe; most frequent mutation. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 426 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 484 The length of the canonical sequence.
Location on the sequence: help LSQQAASVVKQEGGDNDLIE R IQVDAYFSPIHSQLDHLLDP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLL-DP

Mouse                         LSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLL-D

Bovine                        LSQQAAAVVKQEGGDNDLIERIQADAYFSPIHSQLDHLL-D

Chicken                       LSQQAAAVVKQEGGDNDFIARVRADPYFSPIHEHLDSLL-D

Caenorhabditis elegans        TALEAKQLQATQKVD---IRQTMADPFFDSVRDRVVGLVNN

Slime mold                    LTRVSGSKKITESDIQTFIDSLSIP---DDIKSELK-LI-T

Baker's yeast                 LSHQAAAVVKEEGGENDLIERVKRDEFFKPIWEELDSLL-E

Fission yeast                 LSHQAGRVVKEEGGDNDLIERIKNTPYFAPIYDELDSLL-D
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 484 Adenylosuccinate lyase
Cross 415 – 415 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)
Alternative sequence 398 – 456 Missing. In isoform 2.
Helix 423 – 429



Literature citations
Human adenylosuccinate lyase (ADSL), cloning and characterization of full-length cDNA and its isoform, gene structure and molecular basis for ADSL deficiency in six patients.
Kmoch S.; Hartmannova H.; Stiburkova B.; Krijt J.; Zikanova M.; Sebesta I.;
Hum. Mol. Genet. 9:1501-1513(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2); FUNCTION; VARIANTS ADSLD VAL-3; HIS-114; GLN-190; CYS-194; ASN-268; HIS-426 AND ASN-430; Adenylosuccinase deficiency presenting with epilepsy in early infancy.
Maaswinkel-Mooij P.D.; Laan L.A.E.M.; Onkenhout W.; Brouwer O.F.; Jaeken J.; Poorthuis B.J.H.M.;
J. Inherit. Metab. Dis. 20:606-607(1997)
Cited for: VARIANT ADSLD HIS-426; Mutation analysis in adenylosuccinate lyase deficiency: eight novel mutations in the re-evaluated full ADSL coding sequence.
Marie S.; Cuppens H.; Heuterspreute M.; Jaspers M.; Tola E.Z.; Gu X.X.; Legius E.; Vincent M.-F.; Jaeken J.; Cassiman J.-J.; van den Berghe G.;
Hum. Mutat. 13:197-202(1999)
Cited for: VARIANTS ADSLD VAL-72; TRP-141; GLN-190; GLU-246; CYS-303; ARG-395 AND HIS-426; Clinical, biochemical and molecular genetic correlations in adenylosuccinate lyase deficiency.
Race V.; Marie S.; Vincent M.-F.; Van den Berghe G.;
Hum. Mol. Genet. 9:2159-2165(2000)
Cited for: CHARACTERIZATION OF VARIANTS ADSLD VAL-2; LEU-26; TRP-141; CYS-303; ARG-395; HIS-426 AND SER-450; Intrafamilial variability in the phenotypic expression of adenylosuccinate lyase deficiency: a report on three patients.
Edery P.; Chabrier S.; Ceballos-Picot I.; Marie S.; Vincent M.-F.; Tardieu M.;
Am. J. Med. Genet. A 120:185-190(2003)
Cited for: VARIANT ADSLD HIS-426;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.