Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q16637: Variant p.Gly279Cys

Survival motor neuron protein
Gene: SMN2
Feedback?
Variant information Variant position: help 279 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Cysteine (C) at position 279 (G279C, p.Gly279Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SMA2 and SMA3. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 279 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 294 The length of the canonical sequence.
Location on the sequence: help ALGSMLISWYMSGYHTGYYM G FRQNQKEGRCSHSLN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         A----LGSMLISWYMSGYHTGYYMGFRQNQKEG-RCSHSLN

                              A----LGSMLISWYMSGYHTGYYMGFKQNQKEG-RC

Mouse                         A----LGSMLISWYMSGYHTGYYMGFRQNKKEG-KC

Rat                           A----LGSMLISWYMSGYHTGYYMGFRQNKKEGKKC

Bovine                        A----LGSMLISWYMSGYHTGYYMGFKQSQKEG-RY

Cat                           A----LGSMLISWYMSGYHTGYYMGFKQNQKEG-RC

Drosophila                    GAEQDFVAMLTAWYMSGYYTGLYQGKKEASTTSGKK

Fission yeast                 -----YKKLIMSWYYAGYYTGLAEGLAKSEQR----
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 294 Survival motor neuron protein
Region 252 – 280 Involved in homooligomerization
Region 279 – 294 Required for interaction with SYNCRIP
Alternative sequence 279 – 282 GFRQ -> EMLA. In isoform SMN-delta7 and isoform SMN-delta57.
Mutagenesis 260 – 260 L -> S. Impairs homooligomerization.
Mutagenesis 263 – 263 M -> RTA. Impairs homooligomerization and GEMIN8 binding.
Mutagenesis 264 – 264 L -> A. Impairs homooligomerization.
Mutagenesis 266 – 266 S -> P. Impairs homooligomerization and GEMIN8 binding.
Mutagenesis 267 – 267 W -> A. Impairs homooligomerization.
Mutagenesis 268 – 268 Y -> A. Impairs homooligomerization.
Mutagenesis 271 – 271 G -> A. Impairs homooligomerization.
Mutagenesis 272 – 272 Y -> A. Impairs homooligomerization.
Mutagenesis 273 – 273 H -> R. Impairs GEMIN8 binding.
Mutagenesis 274 – 274 T -> A. Impairs homooligomerization.
Mutagenesis 275 – 275 G -> A. Impairs homooligomerization.
Mutagenesis 279 – 279 G -> E. Impairs homooligomerization.
Helix 263 – 280



Literature citations
Identification of a novel missense mutation of the smnt gene in two siblings with spinal muscular atrophy.
Wang C.H.; Papendick B.D.; Bruinsma P.; Day J.K.;
Neurogenetics 1:273-276(1998)
Cited for: VARIANT SMA2/SMA3 CYS-279;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.