Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P10635: Variant p.Gly212Glu

Cytochrome P450 2D6
Gene: CYP2D6
Feedback?
Variant information Variant position: help 212
Type of variant: help LB/B
Residue change: help From Glycine (G) to Glutamate (E) at position 212 (G212E, p.Gly212Glu).
Physico-chemical properties: help Change from glycine (G) to medium size and acidic (E)
BLOSUM score: help -2
Polymorphism: help Genetic variations in CYP2D6 are the cause of poor drug metabolism CYP2D6-related [MIM:608902]. The CYP2D6 gene is highly polymorphic. CYP2D6 activity ranges widely within a population comprising ultrarapid (UM), extensive (EM), intermediate (IM) and poor (PM) metabolizer phenotypes. UM and PM are those most at risk for treatment failure or dose-dependent drug toxicity, respectively. Of the Caucasian populations of Europe and North America, 5%-10% are of the PM phenotype and are unable to metabolize the antihypersensitive drug debrisoquine and numerous other drugs. Different alleles are known, including CYP2D6*1 (PubMed:15768052), CYP2D6*2 (PubMed:25469868), CYP2D6*6B/6C (PubMed:7868129), CYP2D6*7 also known CYP2D6E (PubMed:7845481), CYP2D6*9 also known CYP2D6C (PubMed:1844820), CYP2D6*10 also known CYP2D6J (PubMed:8287064, PubMed:25469868), CYP2D6*12 (PubMed:8655150), CYP2D6*14 (PubMed:10064570), CYP2D6*17 also known CYP2D6Z (PubMed:8971426), CYP2D6*41B (PubMed:15768052), CYP2D6*45A (PubMed:15768052), CYP2D6*45B (PubMed:15768052), CYP2D6*46 (PubMed:15768052), CYP2D6*87 (PubMed:25469868), CYP2D6*88 (PubMed:25469868), CYP2D6*89 (PubMed:25469868), CYP2D6*90 (PubMed:25469868), CYP2D6*91 (PubMed:25469868), CYP2D6*93 (PubMed:25469868), C CYP2D6*94 (PubMed:25469868), CYP2D6*97 (PubMed:25469868) and CYP2D6*98 (PubMed:25469868). Isozymes CYP2D6.45 (Lys-155, Cys-296 and Thr-486) and CYP2D6.46 (His-26, Lys-155, Cys-296 and Thr-486) are functional (PubMed:15768052). The sequence shown is that of isozyme CYP2D6.1 corresponding to allele CYP2D6*1.
Variant description: help In allele CYP2D6*6B and allele CYP2D6*6C.
Other resources: help


Sequence information Variant position: help 212
Protein sequence length: help 497
Location on the sequence: help GRRFEYDDPRFLRLLDLAQE G LKEESGFLREVLNAVPVLLH
Residue conservation: help
Human                         GRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLH

Chimpanzee                    GRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAIPVLLH

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 497 Cytochrome P450 2D6
Helix 200 – 214



Literature citations
An inactive cytochrome P450 CYP2D6 allele containing a deletion and a base substitution.
Daly A.K.; Leathart J.B.; London S.J.; Idle J.R.;
Hum. Genet. 95:337-341(1995)
Cited for: VARIANT GLU-212;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.