Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P78363: Variant p.Val931Met

Retinal-specific phospholipid-transporting ATPase ABCA4
Gene: ABCA4
Feedback?
Variant information Variant position: help 931 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Methionine (M) at position 931 (V931M, p.Val931Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In STGD1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 931 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2273 The length of the canonical sequence.
Location on the sequence: help EGIHDSFFEREHPGWVPGVC V KNLVKIFEPCGRPAVDRLNI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EGIHDSFFER-EHPGWVPGVCVKNLVKIFEP--CGRPAVDRLNI

Mouse                         EGMNDSFFER-ELPGLVPGVCVKNLVKVFEP--SGRPAVDR

Bovine                        EGINDCFFER-ELPGLVPGVCVKNLVKIFEP--YGRPAVDR

Slime mold                    SSYNEKNFEKIEHQLERPTISIRNLRKEFKTGDGNRIAVND

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2273 Retinal-specific phospholipid-transporting ATPase ABCA4
Topological domain 857 – 1376 Cytoplasmic
Domain 929 – 1160 ABC transporter 1
Binding site 938 – 938
Disulfide bond 641 – 1490 Interchain
Mutagenesis 940 – 940 P -> R. Decreases 11-cis-Retinal binding affinity by 50%.
Beta strand 927 – 934



Literature citations
A photoreceptor cell-specific ATP-binding transporter gene (ABCR) is mutated in recessive Stargardt macular dystrophy.
Allikmets R.; Singh N.; Sun H.; Shroyer N.F.; Hutchinson A.; Chidambaram A.; Gerrard B.; Baird L.; Stauffer D.; Peiffer A.; Rattner A.; Smallwood P.M.; Li Y.; Anderson K.L.; Lewis R.A.; Nathans J.; Leppert M.; Dean M.; Lupski J.R.;
Nat. Genet. 15:236-246(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; INVOLVEMENT IN STGD1; VARIANTS GLN-943 AND ASP-1817; VARIANTS STGD1 GLU-818; HIS-846; ALA-863; MET-931; VAL-1028; ALA-1072; LYS-1087 AND TRP-2038; Molecular analysis of the ABCA4 gene for reliable detection of allelic variations in Spanish patients: identification of 21 novel variants.
Aguirre-Lamban J.; Riveiro-Alvarez R.; Maia-Lopes S.; Cantalapiedra D.; Vallespin E.; Avila-Fernandez A.; Villaverde-Montero C.; Trujillo-Tiebas M.J.; Ramos C.; Ayuso C.;
Br. J. Ophthalmol. 93:614-621(2009)
Cited for: VARIANTS STGD1 TRP-602; MET-931; MET-1019; HIS-1108; LEU-1129; LEU-1486; GLN-1640; GLU-1961; SER-1977; PHE-2027 AND HIS-2107; VARIANTS CORD3 LEU-1129 AND ILE-1433; VARIANTS RP19 VAL-156; LEU-1129 AND ILE-1433; VARIANT ILE-552; Frequency of ABCA4 mutations in 278 Spanish controls: an insight into the prevalence of autosomal recessive Stargardt disease.
Riveiro-Alvarez R.; Aguirre-Lamban J.; Lopez-Martinez M.A.; Trujillo-Tiebas M.J.; Cantalapiedra D.; Vallespin E.; Avila-Fernandez A.; Ramos C.; Ayuso C.;
Br. J. Ophthalmol. 93:1359-1364(2009)
Cited for: VARIANTS STGD1 VAL-156; CYS-212; LYS-380; ARG-550; PRO-572; TRP-602; ARG-607; CYS-653; ASP-767; ILE-897; ALA-901; MET-931; SER-965; MET-1019; HIS-1108; LEU-1129; LEU-1380; ILE-1433; LEU-1486; TYR-1490; GLN-1640; TRP-1640; ARG-1748; ASP-1799; PRO-1940; GLU-1961; SER-1977; PHE-2027; ARG-2060; HIS-2107; TYR-2150 AND VAL-2241; Novel mutations in of the ABCR gene in Italian patients with Stargardt disease.
Passerini I.; Sodi A.; Giambene B.; Mariottini A.; Menchini U.; Torricelli F.;
Eye 24:158-164(2010)
Cited for: VARIANTS STGD1 21-GLN--ASP-2273 DEL; LEU-68; HIS-96; LYS-96; SER-172; CYS-212; LYS-415; PRO-541; 572-ARG--ASP-2273 DEL; LYS-616; CYS-653; VAL-690; 700-TRP--ASP-2273 DEL; ASP-767; ARG-821; ARG-840; MET-931; SER-965; PRO-970; PRO-977; ASP-978; MET-1019; VAL-1038; TRP-1055; GLU-1078; LYS-1087; CYS-1098; 1099-SER--ASP-2273 DEL; CYS-1108; 1177-CYS--ASP-2273 DEL; 1332-GLN--ASP-2273 DEL; LEU-1380; 1408-TRP--ASP-2273 DEL; ILE-1433; 1461-TRP--ASP-2273 DEL; 1479-TRP--ASP-2273 DEL; SER-1484; MET-1526; ASP-1598; ASN-1696; GLU-1961; PHE-1970; SER-1977; 2030-ARG--ASP-2273 DEL; LYS-2096; GLN-2140 AND PRO-2221; Outcome of ABCA4 disease-associated alleles in autosomal recessive retinal dystrophies: retrospective analysis in 420 Spanish families.
Riveiro-Alvarez R.; Lopez-Martinez M.A.; Zernant J.; Aguirre-Lamban J.; Cantalapiedra D.; Avila-Fernandez A.; Gimenez A.; Lopez-Molina M.I.; Garcia-Sandoval B.; Blanco-Kelly F.; Corton M.; Tatu S.; Fernandez-San Jose P.; Trujillo-Tiebas M.J.; Ramos C.; Allikmets R.; Ayuso C.;
Ophthalmology 120:2332-2337(2013)
Cited for: VARIANTS STGD1 TRP-18; LEU-153; CYS-212; ALA-291; CYS-537; PRO-541; TRP-602; PRO-611; CYS-653; SER-686; GLU-762; MET-931; ALA-989; MET-1019; ARG-1094; LEU-1096; CYS-1098; HIS-1108; LYS-1122; GLU-1127; LEU-1129; THR-1357; LEU-1380; LEU-1486; MET-1526; ASP-1598; GLN-1640; CYS-1724; ASP-1799; ASP-1805; ASP-1838; ASP-1844; PRO-1940; ARG-1961; GLU-1961; SER-1977; ASN-2047; ARG-2060; GLN-2077; TYR-2137; TYR-2150 AND SER-2188; REVIEW;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.