Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P78363: Variant p.Lys2160Arg

Retinal-specific phospholipid-transporting ATPase ABCA4
Gene: ABCA4
Feedback?
Variant information Variant position: help 2160 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Lysine (K) to Arginine (R) at position 2160 (K2160R, p.Lys2160Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are large size and basic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In STGD1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 2160 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2273 The length of the canonical sequence.
Location on the sequence: help LAIMVKGAFRCMGTIQHLKS K FGDGYIVTMKIKSPKDDLLP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LAIMVKGAFRCMGTIQHLKSKFGDGYIVTMKIKSPKDDLLP

Mouse                         LAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLP

Bovine                        LAIMVKGAFQCLGTIQHLKSKFGDGYIVTMKIRSPKDDLLP

Slime mold                    LTIMKDGKLQALGSNQHIKDKFGSGYSIEVKF---KKEYLE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2273 Retinal-specific phospholipid-transporting ATPase ABCA4
Topological domain 1895 – 2273 Cytoplasmic
Domain 1938 – 2170 ABC transporter 2
Mutagenesis 2175 – 2175 K -> A. 2-fold decreased binding affinity for ATP. Loss of ATPase activity.
Mutagenesis 2180 – 2180 P -> L. Does not affect protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
Helix 2154 – 2160



Literature citations
An analysis of ABCR mutations in British patients with recessive retinal dystrophies.
Papaioannou M.; Ocaka L.; Bessant D.; Lois N.; Bird A.C.; Payne A.; Bhattacharya S.S.;
Invest. Ophthalmol. Vis. Sci. 41:16-19(2000)
Cited for: VARIANTS GLN-943 AND SER-1948; VARIANTS STGD1 TYR-54; ASP-96; HIS-96; VAL-156; VAL-407; ALA-424; ARG-445; TRP-602; 779-CYS--ASP-2273 DEL; ALA-863; ALA-1429; TRP-1640; GLU-1703; 1779-TYR--ASP-2273 DEL AND ARG-2160; VARIANTS CORD3 VAL-407; 2030-ARG--ASP-2273 DEL AND TYR-2150; VARIANT RP19 ALA-424;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.