UniProtKB/SwissProt variant VAR

Variant information

Variant position:

53

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LP/P [Disclaimer]

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Aspartate (D) at position 53 (V53D, p.Val53Asp).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and hydrophobic (V) to medium size and acidic (D)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-3

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In ASGD5; also found in patients with congenital cataract and foveal hypoplasia.

Any additional useful information about the variant.

Sequence information

Variant position:

53

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

422

The length of the canonical sequence.

Location on the sequence:

AHSGARPCDISRILQVSNGC V SKILGRYYETGSIRPRAIGG

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Mouse                         AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Rat                           AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Bovine                        AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Xenopus laevis                AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Zebrafish                     AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Drosophila                    AHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 422	Paired box protein Pax-6
DNA binding	4 – 130	Paired
Region	7 – 63	PAI subdomain
Alternative sequence	47 – 47	Q -> QTHADAKVQVLDNQN. In isoform 5a.
Helix	50 – 63

Literature citations

Missense mutation in the alternative splice region of the PAX6 gene in eye anomalies.
Azuma N.; Yamaguchi Y.; Handa H.; Hayakawa M.; Kanai A.; Yamada M.;
Am. J. Hum. Genet. 65:656-663(1999)
Cited for: VARIANT ASGD5 ASP-53;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P26367: Variant p.Val53Asp