Home  |  Contact

UniProtKB/Swiss-Prot Q02846: Variant p.Pro858Ser

Retinal guanylyl cyclase 1
Gene: GUCY2D
Chromosomal location: 17p13.1
Variant information

Variant position:  858
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Proline (P) to Serine (S) at position 858 (P858S, p.Pro858Ser).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (P) to small size and polar (S)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Leber congenital amaurosis 1 (LCA1) [MIM:204000]: A severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus. {ECO:0000269|PubMed:11035546, ECO:0000269|PubMed:12365911, ECO:0000269|PubMed:15123990, ECO:0000269|PubMed:17724218, ECO:0000269|PubMed:21602930, ECO:0000269|PubMed:8944027, ECO:0000269|PubMed:9888789}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In LCA1; severely impairs basal and GCAP-1 induced activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  858
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1103
The length of the canonical sequence.

Location on the sequence:   RTEELELEKQKTDRLLTQML  P PSVAEALKTGTPVEPEYFEQ
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQ

                              RTEELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEE

Rat                           RTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEYFDQ

Bovine                        RTEELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 52 – 1103 Retinal guanylyl cyclase 1
Topological domain 488 – 1103 Cytoplasmic


Literature citations

Mutational analysis and clinical correlation in Leber congenital amaurosis.
Dharmaraj S.R.; Silva E.R.; Pina A.-L.; Li Y.Y.; Yang J.M.; Carter C.R.; Loyer M.K.; El-Hilali H.K.; Traboulsi E.K.; Sundin O.K.; Zhu D.K.; Koenekoop R.K.; Maumenee I.H.;
Ophthalmic Genet. 21:135-150(2000)
Cited for: VARIANTS LCA1 TYR-105; PRO-325 AND SER-858;

Functional analyses of mutant recessive GUCY2D alleles identified in Leber congenital amaurosis patients: protein domain comparisons and dominant negative effects.
Tucker C.L.; Ramamurthy V.; Pina A.-L.; Loyer M.; Dharmaraj S.; Li Y.; Maumenee I.H.; Hurley J.B.; Koenekoop R.K.;
Mol. Vis. 10:297-303(2004)
Cited for: CHARACTERIZATION OF VARIANTS LCA1 TYR-105; PRO-325; SER-858 AND PRO-954;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.