UniProtKB/SwissProt variant VAR

Variant information

Variant position:

257

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LP/P [Disclaimer]

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Leucine (L) to Proline (P) at position 257 (L257P, p.Leu257Pro).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic.

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-3

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In AIS.

Any additional useful information about the variant.

Sequence information

Variant position:

257

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

920

The length of the canonical sequence.

Location on the sequence:

KELCKAVSVSMGLGVEALEH L SPGEQLRGDCMYAPLLGVPP

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPP

                              KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGGPP

Rhesus macaque                KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPVLGVPP

Chimpanzee                    KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPP

Mouse                         KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPP

Rat                           KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPP

Pig                           KELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLTGPP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 920	Androgen receptor
Region	1 – 587	Interaction with ZNF318
Region	1 – 559	Modulating
Modified residue	258 – 258	Phosphoserine
Modified residue	269 – 269	Phosphotyrosine; by CSK and TNK2
Alternative sequence	1 – 532	Missing. In isoform 2.
Mutagenesis	269 – 269	Y -> F. Decrease of CSK-induced phosphorylation and phosphorylation by TNK2. Complete loss of TNK2-dependent phosphorylation; when associated with F-365.

Literature citations

One additional mutation at exon A amplifies thermolability of androgen receptor in a case with complete androgen insensitivity syndrome.
Tanaka H.; Komori S.; Sakata K.; Shima H.; Koyama K.;
Gynecol. Endocrinol. 12:75-82(1998)
Cited for: VARIANTS AIS PRO-257 AND ALA-821;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P10275: Variant p.Leu257Pro