Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P10275: Variant p.Pro392Arg

Androgen receptor
Gene: AR
Feedback?
Variant information Variant position: help 392 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Arginine (R) at position 392 (P392R, p.Pro392Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In AIS. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 392 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 920 The length of the canonical sequence.
Location on the sequence: help AGPPPPPPPPHPHARIKLEN P LDYGSAWAAAAAQCRYGDLA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLA

                              GGPPPHPPPPHPHTRIKLENPLDYGSAWAAAAAQCRYGDLA

Rhesus macaque                AGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLA

Chimpanzee                    AGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLA

Mouse                         SGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLG

Rat                           SGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLA

Pig                           AGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 920 Androgen receptor
Region 1 – 587 Interaction with ZNF318
Region 1 – 559 Modulating
Modified residue 395 – 395 Phosphotyrosine; by CSK
Cross 388 – 388 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
Alternative sequence 1 – 532 Missing. In isoform 2.
Mutagenesis 395 – 395 Y -> F. Decrease of CSK-induced phosphorylation.



Literature citations
Analysis of exon 1 mutations in the androgen receptor gene.
Gottlieb B.; Vasiliou D.M.; Lumbroso R.; Beitel L.K.; Pinsky L.; Trifiro M.A.;
Hum. Mutat. 14:527-539(1999)
Cited for: VARIANTS AIS ARG-392 AND ARG-445;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.