Home  |  Contact

UniProtKB/Swiss-Prot P35372: Variant p.Asn40Asp

Mu-type opioid receptor
Gene: OPRM1
Variant information

Variant position:  40
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Asparagine (N) to Aspartate (D) at position 40 (N40D, p.Asn40Asp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (N) to medium size and acidic (D)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism:  Variant Asp-40 does not show altered binding affinities for most opioid peptides and alkaloids tested, but it binds beta-endorphin, an endogenous opioid that activates the mu opioid receptor, approximately 3 times more tightly than the most common allelic form.
Additional information on the polymorphism described.

Variant description:  In 10% of the population.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  40
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  400
The length of the canonical sequence.

Location on the sequence:   SSCSPAPSPGSWVNLSHLDG  N LSDPCGPNRTDLGGRDSLCP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCP

Rhesus macaque                SSCSPARSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCP

Chimpanzee                    SSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCP

Mouse                         ASCSPA--PGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCP

Rat                           ASCSPA--PGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCP

Pig                           SMCSPVPSPSSWVNFSHLEGNLSDPCIRNRTELGGSDSLCP

Bovine                        SSCSPAPSPSSWVNFSHLEGNLSDPCGPNRTELGGSDRLCP

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 400 Mu-type opioid receptor
Topological domain 1 – 68 Extracellular
Glycosylation 33 – 33 N-linked (GlcNAc...) asparagine
Glycosylation 40 – 40 N-linked (GlcNAc...) asparagine
Glycosylation 48 – 48 N-linked (GlcNAc...) asparagine
Alternative sequence 1 – 100 Missing. In isoform 12, isoform 14 and isoform 15.
Alternative sequence 1 – 96 MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIV -> MMRAKSISTKAGKPS. In isoform 13.


Literature citations

Expression of two variants of the human mu opioid receptor mRNA in SK-N-SH cells and human brain.
Bare L.A.; Mansson E.; Yang D.;
FEBS Lett. 354:213-216(1994)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2); VARIANT ASP-40; FUNCTION; SUBCELLULAR LOCATION;

Submission
NIEHS SNPs program;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS VAL-6; ASP-40; CYS-147; ASP-152; CYS-265 AND ASN-274;

Mu opioid receptor gene variants: lack of association with alcohol dependence.
Bergen A.W.; Kokoszka J.; Peterson R.; Long J.C.; Virkkunen M.; Linnoila M.; Goldman D.;
Mol. Psychiatry 2:490-494(1997)
Cited for: VARIANTS VAL-6; ASP-40 AND CYS-147;

Single-nucleotide polymorphism in the human mu opioid receptor gene alters beta-endorphin binding and activity: possible implications for opiate addiction.
Bond C.; LaForge K.S.; Tian M.; Melia D.; Zhang S.; Borg L.; Gong J.; Schluger J.; Strong J.A.; Leal S.M.; Tischfield J.A.; Kreek M.J.; Yu L.;
Proc. Natl. Acad. Sci. U.S.A. 95:9608-9613(1998)
Cited for: VARIANTS VAL-6; ASP-40 AND HIS-260; CHARACTERIZATION OF VARIANT ASP-40; POLYMORPHISM; FUNCTION; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.