Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P10636: Variant p.Pro618Leu

Microtubule-associated protein tau
Gene: MAPT
Feedback?
Variant information Variant position: help 618 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Leucine (L) at position 618 (P618L, p.Pro618Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In FTD1; most common mutation; reduction in the ability to promote microtubule assembly; accelerates aggregation of tau into filaments. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 618 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 758 The length of the canonical sequence.
Location on the sequence: help KLDLSNVQSKCGSKDNIKHV P GGGSVQIVYKPVDLSKVTSK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Gorilla                       KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Rhesus macaque                KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Chimpanzee                    KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Mouse                         KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Rat                           KLDLSNVQSKCGSKDNIKHVPGGGSVHIVYKPVDLSKVTSK

Bovine                        KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Goat                          KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 758 Microtubule-associated protein tau
Repeat 592 – 622 Tau/MAP 2
Region 561 – 685 Microtubule-binding domain
Site 607 – 607 Not glycated
Site 611 – 611 Not glycated
Site 615 – 615 Not glycated
Site 628 – 628 Not glycated
Site 634 – 634 Not glycated
Site 638 – 638 Not glycated
Modified residue 598 – 598 N6-acetyllysine; alternate
Modified residue 602 – 602 Phosphoserine; by PHK
Modified residue 607 – 607 N6-acetyllysine
Modified residue 610 – 610 Phosphoserine
Modified residue 615 – 615 N6-acetyllysine; alternate
Modified residue 622 – 622 Phosphoserine; by PHK
Modified residue 628 – 628 N6,N6-dimethyllysine; alternate
Modified residue 628 – 628 N6-acetyllysine; alternate
Modified residue 634 – 634 N6-acetyllysine; alternate
Modified residue 638 – 638 N6-acetyllysine; alternate
Glycosylation 598 – 598 N-linked (Glc) (glycation) lysine; in PHF-tau; in vitro
Disulfide bond 608 – 639
Cross 598 – 598 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 615 – 615 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 628 – 628 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); in PHF-tau
Cross 634 – 634 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 638 – 638 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Alternative sequence 592 – 622 Missing. In isoform Tau-A, isoform Tau-B, isoform Tau-C and isoform Fetal-tau.
Beta strand 618 – 620



Literature citations
Segregation of a missense mutation in the microtubule-associated protein tau gene with familial frontotemporal dementia and parkinsonism.
Dumanchin C.; Camuzat A.; Campion D.; Verpillat P.; Hannequin D.; Dubois B.; Saugier-Veber P.; Martin C.; Penet C.; Charbonnier F.; Agid Y.; Frebourg T.; Brice A.;
Hum. Mol. Genet. 7:1825-1829(1998)
Cited for: VARIANT FTD1 LEU-618; Association of missense and 5'-splice-site mutations in tau with the inherited dementia FTDP-17.
Hutton M.; Lendon C.L.; Rizzu P.; Baker M.; Froelich S.; Houlden H.; Pickering-Brown S.; Chakraverty S.; Isaacs A.; Grover A.; Hackett J.; Adamson J.; Lincoln S.; Dickson D.; Davies P.; Petersen R.C.; Stevens M.; de Graaff E.; Wauters E.; van Baren J.; Hillebrand M.; Joosse M.; Kwon J.M.; Nowotny P.; Che L.K.; Norton J.; Morris J.C.; Reed L.A.; Trojanowski J.; Basun H.; Lannfelt L.; Neystat M.; Fahn S.; Dark F.; Tannenberg T.; Dodd P.R.; Hayward N.; Kwok J.B.J.; Schofield P.R.; Andreadis A.; Snowden J.; Craufurd D.; Neary D.; Owen F.; Oostra B.A.; Hardy J.; Goate A.; van Swieten J.; Mann D.; Lynch T.; Heutink P.;
Nature 393:702-705(1998)
Cited for: VARIANTS FTD1 VAL-589; LEU-618 AND TRP-723; Pathogenic implications of mutations in the tau gene in pallido-ponto-nigral degeneration and related neurodegenerative disorders linked to chromosome 17.
Clark L.N.; Poorkaj P.; Wszolek Z.; Geschwind D.H.; Nasreddine Z.S.; Miller B.; Li D.; Payami H.; Awert F.; Markopoulou K.; Andreadis A.; D'Souza I.; Lee V.M.-Y.; Reed L.; Trojanowski J.Q.; Zhukareva V.; Bird T.; Schellenberg G.; Wilhelmsen K.C.;
Proc. Natl. Acad. Sci. U.S.A. 95:13103-13107(1998)
Cited for: VARIANTS FTD1 LYS-596 AND LEU-618; High prevalence of mutations in the microtubule-associated protein tau in a population study of frontotemporal dementia in the Netherlands.
Rizzu P.; Van Swieten J.C.; Joosse M.; Hasegawa M.; Stevens M.; Tibben A.; Niermeijer M.F.; Hillebrand M.; Ravid R.; Oostra B.A.; Goedert M.; van Duijn C.M.; Heutink P.;
Am. J. Hum. Genet. 64:414-421(1999)
Cited for: VARIANTS FTD1 VAL-589; LYS-597 DEL; LEU-618 AND TRP-723; Accelerated filament formation from tau protein with specific FTDP-17 missense mutations.
Nacharaju P.; Lewis J.; Easson C.; Yen S.; Hackett J.; Hutton M.; Yen S.H.;
FEBS Lett. 447:195-199(1999)
Cited for: VARIANTS FTD1 LEU-618; MET-654 AND TRP-723;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.