Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P20823: Variant p.Val259Asp

Hepatocyte nuclear factor 1-alpha
Gene: HNF1A
Feedback?
Variant information Variant position: help 259 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Aspartate (D) at position 259 (V259D, p.Val259Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (V) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MODY3; uncertain significance. Any additional useful information about the variant.


Sequence information Variant position: help 259 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 631 The length of the canonical sequence.
Location on the sequence: help AECIQRGVSPSQAQGLGSNL V TEVRVYNWFANRRKEEAFRH The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Mouse                         AECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Rat                           AECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Chicken                       AECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 631 Hepatocyte nuclear factor 1-alpha
DNA binding 199 – 279 Homeobox; HNF1-type
Modified residue 247 – 247 Phosphoserine
Alternative sequence 120 – 631 Missing. In isoform 8.
Alternative sequence 176 – 278 QFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR -> RRNASREGCPHHRHRGWAPTSSRRCVSTTGLPTGAKKKPSGTSWPWTRTAGPPQGQARDLRCPLTAPLACLHLPSPPVRSTVCAMDSLRPVRLQKYPQAAAVP. In isoform 4.
Alternative sequence 248 – 631 Missing. In isoform 5.
Mutagenesis 246 – 246 V -> D. Reduces transcription activation by 75%.
Mutagenesis 257 – 257 N -> W. Reduces transcription activation by 70%.



Literature citations
An automated fluorescent single-strand conformation polymorphism technique for screening mutations in the hepatocyte nuclear factor-1alpha gene (maturity-onset diabetes of the young).
Boutin P.; Chevre J.-C.; Hani E.H.; Gomis R.; Pardini V.C.; Guillausseau P.-J.; Vaxillaire M.; Velho G.; Froguel P.;
Diabetes 46:2108-2109(1997)
Cited for: VARIANTS MODY3 ASP-259 AND ILE-594;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.