UniProtKB/Swiss-Prot O76024: Variant p.Ile720Val

Wolframin
Gene: WFS1
Chromosomal location: 4p16.1
Variant information

Variant position:  720
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Isoleucine (I) to Valine (V) at position 720 (I720V, p.Ile720Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism:  Arg-456-His, Arg-611-His and Ile-720-Val polymorphisms are in tight linkage disequilibrium with one another and associated with type 1 diabetes in Japanese.
Additional information on the polymorphism described.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  720
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  890
The length of the canonical sequence.

Location on the sequence:   WTGRFKYVRVTDIDNSAESA  I NMLPFFIGDWMRCLYGEAYP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         WTGRFKYVRVTDIDNSAESAI-NMLPFFIGDWMRCLYGEAYP

Mouse                         WTGRFKYVRVTEIDNSAESAI-NMLPFFLGDWMRCLYGEAY

Drosophila                    WEGSVTKVEISRVSNFLEDTIANYLPVWLGRMLRCLHGENI

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 890 Wolframin
Topological domain 653 – 869 Lumenal


Literature citations

Missense variations of the gene responsible for Wolfram syndrome (WFS1/wolframin) in Japanese: possible contribution of the Arg456His mutation to type 1 diabetes as a nonautoimmune genetic basis.
Awata T.; Inoue K.; Kurihara S.; Ohkubo T.; Inoue I.; Abe T.; Takino H.; Kanazawa Y.; Katayama S.;
Biochem. Biophys. Res. Commun. 268:612-616(2000)
Cited for: VARIANTS HIS-456; SER-576; HIS-611; CYS-653 AND VAL-720;

WFS1 gene mutation search in depressive patients: detection of five missense polymorphisms but no association with depression or bipolar affective disorder.
Ohtsuki T.; Ishiguro H.; Yoshikawa T.; Arinami T.;
J. Affect. Disord. 58:11-17(2000)
Cited for: VARIANTS HIS-456; SER-576; HIS-611; VAL-720 AND LYS-737;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.