Home  |  Contact

UniProtKB/Swiss-Prot P56539: Variant p.Cys72Trp

Caveolin-3
Gene: CAV3
Variant information

Variant position:  72
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Cysteine (C) to Tryptophan (W) at position 72 (C72W, p.Cys72Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  72
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  151
The length of the canonical sequence.

Location on the sequence:   YSFDGVWKVSYTTFTVSKYW  C YRLLSTLLGVPLALLWGFLF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         YSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLF

Mouse                         YSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLF

Rat                           YSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLF

Pig                           YSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLF

Bovine                        YSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 151 Caveolin-3
Topological domain 1 – 83 Cytoplasmic
Region 64 – 114 Required for interaction with DAG1


Literature citations

Caveolin-3 in muscular dystrophy.
McNally E.M.; de Sa Moreira E.; Duggan D.J.; Bonnemann C.G.; Lisanti M.P.; Lidov H.G.W.; Vainzof M.; Passos-Bueno M.R.; Hoffman E.P.; Zatz M.; Kunkel L.M.;
Hum. Mol. Genet. 7:871-877(1998)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]; VARIANTS SER-56 AND TRP-72;

Mutations in the caveolin-3 gene: when are they pathogenic?
de Paula F.; Vainzof M.; Bernardino A.L.F.; McNally E.; Kunkel L.M.; Zatz M.;
Am. J. Med. Genet. 99:303-307(2001)
Cited for: VARIANTS SER-56; TRP-72 AND HIS-126;

Mutant caveolin-3 induces persistent late sodium current and is associated with long-QT syndrome.
Vatta M.; Ackerman M.J.; Ye B.; Makielski J.C.; Ughanze E.E.; Taylor E.W.; Tester D.J.; Balijepalli R.C.; Foell J.D.; Li Z.; Kamp T.J.; Towbin J.A.;
Circulation 114:2104-2112(2006)
Cited for: VARIANTS LQT9 MET-78; THR-85; CYS-97 AND ARG-141; VARIANTS SER-56 AND TRP-72; CHARACTERIZATION OF VARIANTS LQT9 CYS-97 AND ARG-141;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.