Home  |  Contact

UniProtKB/Swiss-Prot Q13315: Variant p.Asp2625Gln

Serine-protein kinase ATM
Gene: ATM
Variant information

Variant position:  2625
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Aspartate (D) to Glutamine (Q) at position 2625 (D2625Q, p.Asp2625Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (D) to medium size and polar (Q)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In AT; requires 2 nucleotide substitutions.
Any additional useful information about the variant.



Sequence information

Variant position:  2625
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  3056
The length of the canonical sequence.

Location on the sequence:   IICTIRSRRPQMVRSVEALC  D AYIILANLDATQWKTQRKGI
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         IICTIRSRRPQMVRSVEALCDAYIILANLDAT-QWKTQRKGI------

Mouse                         IIHSIRSKRCKMVKDMEALCDAYIILANMDAS-QWRAQRKG

Pig                           VICTLRNRRRQMVRSVEALCDAYIILANLDAT-QWRTQRKG

Caenorhabditis elegans        ADQRDSSKLKEIVITIREAHQAYREIAMLDVRGNVRIQRVE

Drosophila                    MICEKNGTAGECSKQLESLLPALITFANEGKTNDNRPVSDS

Baker's yeast                 QGYDRGAFAKKYLLPVQEFCEMSVELANLKFVQNTKTLRLA

Fission yeast                 -LLKVNQGLSNLVTKLLCSFENYVSLA------EWNP-RSK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 3056 Serine-protein kinase ATM
Helix 2614 – 2632


Literature citations

Mutations at the ataxia-telangiectasia locus and clinical phenotypes of A-T patients.
Li A.; Swift M.;
Am. J. Med. Genet. 92:170-177(2000)
Cited for: VARIANTS AT GLU-224; VAL-323; PRO-1420; CYS-2218; 2546-SER--ILE-2548 DEL; GLN-2625; CYS-2832; 2855-ARG-ILE-2856 AND CYS-3008; VARIANTS VAL-1853 AND ILE-2438;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.