Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O43526: Variant p.Ala306Thr

Potassium voltage-gated channel subfamily KQT member 2
Gene: KCNQ2
Feedback?
Variant information Variant position: help 306 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Alanine (A) to Threonine (T) at position 306 (A306T, p.Ala306Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BFNS1 and DEE7; 20%-40% reduction of wt current in heteromeric channels. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 306 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 872 The length of the canonical sequence.
Location on the sequence: help QTWNGRLLAATFTLIGVSFF A LPAGILGSGFALKVQEQHRQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         QTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQ

Mouse                         QTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRP

Rat                           QTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQ
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 872 Potassium voltage-gated channel subfamily KQT member 2
Transmembrane 292 – 312 Helical; Name=Segment S6
Region 222 – 323 Mediates interaction with SLC5A3



Literature citations
A novel potassium channel gene, KCNQ2, is mutated in an inherited epilepsy of newborns.
Singh N.A.; Charlier C.; Stauffer D.; DuPont B.R.; Leach R.J.; Melis R.; Ronen G.M.; Bjerre I.; Quattlebaum T.; Murphy J.V.; McHarg M.L.; Gagnon D.; Rosales T.O.; Peiffer A.; Anderson V.E.; Leppert M.;
Nat. Genet. 18:25-29(1998)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANTS BFNS1 CYS-284 AND THR-306; Moderate loss of function of cyclic-AMP-modulated KCNQ2/KCNQ3 K+ channels causes epilepsy.
Schroeder B.C.; Kubisch C.; Stein V.; Jentsch T.J.;
Nature 396:687-690(1998)
Cited for: MUTAGENESIS OF SER-52 AND GLY-279; PHOSPHORYLATION AT SER-52; CHARACTERIZATION OF VARIANTS CYS-284 AND THR-306; KCNQ2 and KCNQ3 potassium channel genes in benign familial neonatal convulsions: expansion of the functional and mutation spectrum.
Singh N.A.; Westenskow P.; Charlier C.; Pappas C.; Leslie J.; Dillon J.; Anderson V.E.; Sanguinetti M.C.; Leppert M.F.;
Brain 126:2726-2737(2003)
Cited for: VARIANTS BFNS1 VAL-208; GLN-228; PHE-243; CYS-284; THR-306 AND GLN-333; CHARACTERIZATION OF VARIANTS BFNS1 VAL-208 AND GLN-333; FUNCTION; Whole-exome sequencing improves the diagnosis yield in sporadic infantile spasm syndrome.
Dimassi S.; Labalme A.; Ville D.; Calender A.; Mignot C.; Boutry-Kryza N.; de Bellescize J.; Rivier-Ringenbach C.; Bourel-Ponchel E.; Cheillan D.; Simonet T.; Maincent K.; Rossi M.; Till M.; Mougou-Zerelli S.; Edery P.; Saad A.; Heron D.; des Portes V.; Sanlaville D.; Lesca G.;
Clin. Genet. 89:198-204(2016)
Cited for: VARIANT DEE7 THR-306;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.