Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13635: Variant p.Pro1315Leu

Protein patched homolog 1
Gene: PTCH1
Feedback?
Variant information Variant position: help 1315 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Leucine (L) at position 1315 (P1315L, p.Pro1315Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1315 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1447 The length of the canonical sequence.
Location on the sequence: help PGRQGQQPRRDPPREGLWPP P YRPRRDAFEISTEGHSGPSN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSN

Mouse                         PGRQGQQPRRDPPREGLRPPPYRPRRDAFEISTEGHSGPSN

Chicken                       VWHQGRQPKQE-VREGLRPPPYRPRRDAFEISTEGHSGPSN

Zebrafish                     ---------------------------------AGHIPKAS

Caenorhabditis elegans        ---------------------------------SRQAPPTT

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1447 Protein patched homolog 1
Topological domain 1176 – 1447 Cytoplasmic
Region 1270 – 1360 Disordered



Literature citations
Human homolog of patched, a candidate gene for the basal cell nevus syndrome.
Johnson R.L.; Rothman A.L.; Xie J.; Goodrich L.V.; Bare J.W.; Bonifas J.M.; Quinn A.G.; Myers R.M.; Cox D.R.; Epstein E.H. Jr.; Scott M.P.;
Science 272:1668-1671(1996)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM L); VARIANTS BCNS1 PRO-175 AND PRO-ASN-ILE-815 INS; VARIANT LEU-1315;
A mammalian patched homolog is expressed in target tissues of sonic hedgehog and maps to a region associated with developmental abnormalities.
Hahn H.; Christiansen J.; Wicking C.; Zaphiropolous P.G.; Chidambaram A.; Gerrard B.; Vorechovsky I.; Bale A.E.; Toftgard R.; Dean M.; Wainwright B.J.;
J. Biol. Chem. 271:12125-12128(1996)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM S); VARIANT LEU-1315;
Gorlin syndrome: identification of 4 novel germ-line mutations of the human patched (PTCH) gene.
Hasenpusch-Theil K.; Bataille V.; Laehdetie J.; Obermayr F.; Sampson J.R.; Frischauf A.-M.;
Hum. Mutat. 11:480-480(1998)
Cited for: VARIANT LEU-1315;
Identification of PATCHED mutations in medulloblastomas by direct sequencing.
Dong J.; Gailani M.R.; Pomeroy S.L.; Reardon D.; Bale A.E.;
Hum. Mutat. 16:89-90(2000)
Cited for: VARIANT LEU-1315;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.