Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13563: Variant p.Ala356Pro

Polycystin-2
Gene: PKD2
Feedback?
Variant information Variant position: help 356 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Alanine (A) to Proline (P) at position 356 (A356P, p.Ala356Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In PKD2. Any additional useful information about the variant.


Sequence information Variant position: help 356 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 968 The length of the canonical sequence.
Location on the sequence: help DLRDEIKECYDVYSVSSEDR A PFGPRNGTAWIYTSEKDLNG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DLRDEIKECYDVYSVSSEDR-APFGPRNGTAWIYTSEKDLNG

Mouse                         DLRDEIKECYDVYSVSSEDR-APFGPRNGTAWMYTSEKELN

Bovine                        DLRDEIKECYDVYSVSSEDR-APFGPRNGTAWIYTSEKDLN

Zebrafish                     DLRDEVYDCYNVYSPANEDK-APFGPKNGTAWRFKDESSLG

Caenorhabditis elegans        SFQREIKECFANYEEKLEDK-TMVGDGSVDAFIYATAKELE

Fission yeast                 -------DVFTWYVKSTGGTPSTLVDLGIHANVALAKRGID
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 968 Polycystin-2
Topological domain 242 – 468 Extracellular
Glycosylation 362 – 362 N-linked (GlcNAc...) asparagine
Glycosylation 375 – 375 N-linked (GlcNAc...) asparagine



Literature citations
Seven novel mutations of the PKD2 gene in families with autosomal dominant polycystic kidney disease.
Torra R.; Viribay M.; Telleria D.; Badenas C.; Watson M.; Harris P.C.; Darnell A.; San Millan J.L.;
Kidney Int. 56:28-33(1999)
Cited for: VARIANT PKD2 PRO-356; VARIANT PRO-28; Genotype-renal function correlation in type 2 autosomal dominant polycystic kidney disease.
Magistroni R.; He N.; Wang K.; Andrew R.; Johnson A.; Gabow P.; Dicks E.; Parfrey P.; Torra R.; San-Millan J.L.; Coto E.; Van Dijk M.; Breuning M.; Peters D.; Bogdanova N.; Ligabue G.; Albertazzi A.; Hateboer N.; Demetriou K.; Pierides A.; Deltas C.; St George-Hyslop P.; Ravine D.; Pei Y.;
J. Am. Soc. Nephrol. 14:1164-1174(2003)
Cited for: VARIANTS PKD2 PRO-356; GLY-414; ARG-632 AND GLN-807;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.