Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9BZS1: Variant p.Phe371Cys

Forkhead box protein P3
Gene: FOXP3
Feedback?
Variant information Variant position: help 371 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Phenylalanine (F) to Cysteine (C) at position 371 (F371C, p.Phe371Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (F) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In IPEX; no effect on dimerization. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 371 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 431 The length of the canonical sequence.
Location on the sequence: help LEAPEKQRTLNEIYHWFTRM F AFFRNHPATWKNAIRHNLSL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSL

Mouse                         LEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSL
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 431 Forkhead box protein P3
Chain 1 – 417 Forkhead box protein P3, C-terminally processed
Chain 52 – 417 Forkhead box protein P3 41 kDa form
DNA binding 337 – 423 Fork-head
Alternative sequence 382 – 382 K -> KVSSSEVAVTGMASSAIAAQSGQAWVWAHRHIGEERDVGCWWWLLASEVDAHLLPVPGLPQ. In isoform 3.
Mutagenesis 370 – 370 M -> T. Disrupts dimerization but does not affect DNA-binding; when associated with Q-348. Disrupts dimerization, does not affect DNA-binding, causes dysregulated expression of a subset of FOXP3 target genes and impairs its ability to confer inhibitory function to regulatory T-cells; when associated with Q-348 and P-372.
Mutagenesis 372 – 372 A -> P. Disrupts dimerization, does not affect DNA-binding, causes dysregulated expression of a subset of FOXP3 target genes and impairs its ability to confer inhibitory function to regulatory T-cells; when associated with Q-348 and T-370.
Helix 360 – 371



Literature citations
Structure of a domain-swapped FOXP3 dimer on DNA and its function in regulatory T cells.
Bandukwala H.S.; Wu Y.; Feuerer M.; Chen Y.; Barboza B.; Ghosh S.; Stroud J.C.; Benoist C.; Mathis D.; Rao A.; Chen L.;
Immunity 34:479-491(2011)
Cited for: X-RAY CRYSTALLOGRAPHY (2.80 ANGSTROMS) OF 336-417 IN COMPLEX WITH DNA AND NFATC2; FUNCTION; SUBUNIT; DOMAIN FORK-HEAD; INTERACTION WITH NFATC2; CHARACTERIZATION OF VARIANTS IPEX GLU-251 DEL; HIS-347; CYS-371 AND ALA-373; MUTAGENESIS OF TRP-348; MET-370 AND ALA-372; X-linked neonatal diabetes mellitus, enteropathy and endocrinopathy syndrome is the human equivalent of mouse scurfy.
Wildin R.S.; Ramsdell F.; Peake J.; Faravelli F.; Casanova J.-L.; Buist N.; Levy-Lahad E.; Mazzella M.; Goulet O.; Perroni L.; Bricarelli F.D.; Byrne G.; McEuen M.; Proll S.; Appleby M.; Brunkow M.E.;
Nat. Genet. 27:18-20(2001)
Cited for: VARIANTS IPEX CYS-371; THR-384 AND TRP-397;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.