UniProtKB/SwissProt variant VAR

Variant information

Variant position:

1314

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Arginine (R) to Tryptophan (W) at position 1314 (R1314W, p.Arg1314Trp).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from large size and basic (R) to large size and aromatic (W)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-3

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In GACI2 and PXE; autosomal recessive.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs63750759 [ dbSNP | Ensembl ]

Sequence information

Variant position:

1314

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

1503

The length of the canonical sequence.

Location on the sequence:

KVGIVGRTGAGKSSLASGLL R LQEAAEGGIWIDGVPIAHVG

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVG

Mouse                         KVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWIDGVPITHVG

Rat                           KVGIVGRTGAGKSSLTWGLLRLQEATEGGIWIDGVPITDMG

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1503	Multidrug resistance-associated protein 6
Topological domain	1220 – 1503	Cytoplasmic
Domain	1265 – 1499	ABC transporter 2
Alternative sequence	100 – 1503	Missing. In isoform 2.
Alternative sequence	872 – 1503	Missing. In isoform 3.

Literature citations

Mutations in a gene encoding an ABC transporter cause pseudoxanthoma elasticum.
Le Saux O.; Urban Z.; Tschuch C.; Csiszar K.; Bacchelli B.; Quaglino D.; Pasquali-Ronchetti I.; Pope F.M.; Richards A.; Terry S.; Bercovitch L.; de Paepe A.; Boyd C.D.;
Nat. Genet. 25:223-227(2000)
Cited for: VARIANTS PXE PRO-1114; GLN-1138 AND TRP-1314; VARIANT ALA-614;

A spectrum of ABCC6 mutations is responsible for pseudoxanthoma elasticum.
Le Saux O.; Beck K.; Sachsinger C.; Silvestri C.; Treiber C.; Goering H.H.H.; Johnson E.W.; De Paepe A.; Pope F.M.; Pasquali-Ronchetti I.; Bercovitch L.; Terry S.; Boyd C.D.;
Am. J. Hum. Genet. 69:749-764(2001)
Cited for: VARIANTS PXE LYS-411; GLN-518; SER-568; PRO-673; GLN-765; PRO-1114; TRP-1121; PRO-1138; GLN-1138; ASP-1203; PHE-1298; ILE-1301; ARG-1302; PRO-1303; GLN-1314; TRP-1314; SER-1321; CYS-1339; HIS-1347; ASN-1361 AND THR-1424; VARIANTS ASP-61; ARG-207; GLY-265; GLU-281; VAL-319; LYS-497; ALA-614; GLN-632; HIS-953; CYS-1241 AND GLN-1268;

Mutation detection in the ABCC6 gene and genotype-phenotype analysis in a large international case series affected by pseudoxanthoma elasticum.
Pfendner E.G.; Vanakker O.M.; Terry S.F.; Vourthis S.; McAndrew P.E.; McClain M.R.; Fratta S.; Marais A.S.; Hariri S.; Coucke P.J.; Ramsay M.; Viljoen D.; Terry P.F.; De Paepe A.; Uitto J.; Bercovitch L.G.;
J. Med. Genet. 44:621-628(2007)
Cited for: VARIANTS PXE 60-ARG--TYR-62 DEL; ARG-317; ARG-364; TRP-382; GLY-391; ASN-392; HIS-463 HIS-495; GLN-518; PRO-535; SER-568; CYS-600; CYS-663; PRO-698; ASP-699; PRO-726; LYS-751; ARG-755; TRP-760; GLN-765; ASN-777; MET-811; SER-881; ILE-944; THR-950; ARG-992; CYS-1114; MET-1130; ALA-1133; GLN-1138; TRP-1138; THR-1139; GLN-1164; CYS-1221; HIS-1221; ILE-1226; PHE-1298; ARG-1302; PRO-1303; GLN-1314; TRP-1314; GLN-1335; CYS-1339; HIS-1339 AND THR-1342;

Generalized arterial calcification of infancy and pseudoxanthoma elasticum can be caused by mutations in either ENPP1 or ABCC6.
Nitschke Y.; Baujat G.; Botschen U.; Wittkampf T.; du Moulin M.; Stella J.; Le Merrer M.; Guest G.; Lambot K.; Tazarourte-Pinturier M.F.; Chassaing N.; Roche O.; Feenstra I.; Loechner K.; Deshpande C.; Garber S.J.; Chikarmane R.; Steinmann B.; Shahinyan T.; Martorell L.; Davies J.; Smith W.E.; Kahler S.G.; McCulloch M.; Wraige E.; Loidi L.; Hohne W.; Martin L.; Hadj-Rabia S.; Terkeltaub R.; Rutsch F.;
Am. J. Hum. Genet. 90:25-39(2012)
Cited for: VARIANTS GACI2 ARG-355; GLY-391; PHE-590; PHE-1036 DEL; CYS-1114; HIS-1221 AND TRP-1314;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O95255: Variant p.Arg1314Trp