Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P24394: Variant p.Ser752Ala

Interleukin-4 receptor subunit alpha
Gene: IL4R
Feedback?
Variant information Variant position: help 752 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Alanine (A) at position 752 (S752A, p.Ser752Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Allelic variants in IL4RA are associated with a susceptibility to atopy, an immunological condition that can lead to clinical symptoms such as allergic rhinitis, sinusitis, asthma and eczema.Allelic variants in IL4RA are associated with cedar pollen sensitization. Individuals develop Japanese cedar pollinosis with increased exposure to cedar pollen. Japanese cedar pollinosis is a type I allergic disease with ocular and nasal symptoms that develop paroxysmally on contact with Japanese cedar pollen. These symptoms, which occur seasonally each year, are typical features of allergic rhinitis, such as sneezing, excessive nasal secretion, nasal congestion, and conjunctival itching. - Additional information on the polymorphism described.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 752 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 825 The length of the canonical sequence.
Location on the sequence: help DGGQTPVMASPCCGCCCGDR S SPPTTPLRAPDPSPGGVPLE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         DGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLE

Mouse                         EGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPE

Rat                           EDGQIHVVASPGCGCCYDEKSPSLGNLSGTLESCPGEMSQE

Pig                           DGGKVHVVASPCCSCCCEDGSPPMVTPLRAPDAPSSGVPLE

Horse                         EHGEAHTVASPCCGCCCGDRSSPPVSPVRALDPPPGGVPLE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 26 – 825 Interleukin-4 receptor subunit alpha
Topological domain 257 – 825 Cytoplasmic
Alternative sequence 228 – 825 Missing. In isoform 2.



Literature citations
Submission
SeattleSNPs variation discovery resource;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS VAL-75; ALA-400; ARG-431; LEU-436; PRO-503; ARG-576; ILE-579; SER-675 AND ALA-752; Variation in the interleukin 4-receptor alpha gene confers susceptibility to asthma and atopy in ethnically diverse populations.
Ober C.; Leavitt S.A.; Tsalenko A.; Howard T.D.; Hoki D.M.; Daniel R.; Newman D.L.; Wu X.; Parry R.; Lester L.A.; Solway J.; Blumenthal M.; King R.A.; Xu J.; Meyers D.A.; Bleecker E.R.; Cox N.J.;
Am. J. Hum. Genet. 66:517-526(2000)
Cited for: VARIANT ALA-752;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.