UniProtKB/Swiss-Prot P24394: Variant p.Ser786Pro

Interleukin-4 receptor subunit alpha
Gene: IL4R
Feedback?

Variant information Variant position:

786 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Serine (S) to Proline (P) at position 786 (S786P, p.Ser786Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and polar (S) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Allelic variants in IL4RA are associated with a susceptibility to atopy, an immunological condition that can lead to clinical symptoms such as allergic rhinitis, sinusitis, asthma and eczema.Allelic variants in IL4RA are associated with cedar pollen sensitization. Individuals develop Japanese cedar pollinosis with increased exposure to cedar pollen. Japanese cedar pollinosis is a type I allergic disease with ocular and nasal symptoms that develop paroxysmally on contact with Japanese cedar pollen. These symptoms, which occur seasonally each year, are typical features of allergic rhinitis, such as sneezing, excessive nasal secretion, nasal congestion, and conjunctival itching. - Additional information on the polymorphism described.
Variant description:

In 1.8% of the population. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs1805014 [ dbSNP | Ensembl ]

Sequence information Variant position:

786 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

825 The length of the canonical sequence.
Location on the sequence:

PGGVPLEASLCPASLAPSGI S EKSKSSSSFHPAPGNAQSSS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PGGVPLEASLCPASLAPSGISEKSKSSSSFHPAPGNAQSSS

Mouse                         PEGIPPEANLMSAPKTPSNLSGEGKG-------PGHSPVPS

Rat                           PGEMSQEANLTLAPRTPSNLSGVGKG-------PGHSPVPS

Pig                           SSGVPLEASLSPASLALLGVSREGKIPPCLQITPSNVQSSS

Horse                         PGGVPLEAGLSLASLGSLGLSEERKPSLFFQPAPGNAQSSS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	26 – 825	Interleukin-4 receptor subunit alpha
Topological domain	257 – 825	Cytoplasmic
Region	782 – 809	Disordered
Compositional bias	784 – 809	Polar residues
Alternative sequence	228 – 825	Missing. In isoform 2.

Literature citations
Common polymorphisms in the coding part of the IL4-receptor gene.
Deichmann K.; Bardutzky J.; Forster J.; Heinzmann A.; Kuehr J.;
Biochem. Biophys. Res. Commun. 231:696-697(1997)
Cited for: VARIANTS VAL-75; ALA-400; ARG-431; LEU-436 AND PRO-786; Analysis of the Ser786Pro interleukin-4 receptor alpha allelic variant in allergic and nonallergic asthma and its functional consequences.
Andrews R.P.; Burrell L.; Rosa-Rosa L.; Cunningham C.M.; Brzezinski J.L.; Bernstein J.A.; Khurana Hershey G.K.;
Clin. Immunol. 100:298-304(2001)
Cited for: VARIANT PRO-786;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.