UniProtKB/Swiss-Prot P16581: Variant p.Cys130Trp

E-selectin
Gene: SELE
Feedback?

Variant information Variant position:

130 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Cysteine (C) to Tryptophan (W) at position 130 (C130W, p.Cys130Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (C) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

A polymorphism in position 149 is associated with a higher risk of coronary artery disease (CAD). A significantly higher mutation frequency (Arg-149) is observed in patients with angiographically proven severe atherosclerosis compared with an unselected population (Ser-149). Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs5360 [ dbSNP | Ensembl ]

Sequence information Variant position:

130 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

610 The length of the canonical sequence.
Location on the sequence:

DCVEIYIKREKDVGMWNDER C SKKKLALCYTAACTNTSCSG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSG

                              DCVEIYIKRDKDSGKWNDERCDKKKLALCYTAACTPTSCSG

Mouse                         DCVEIYIQRTKDSGMWNDERCNKKKLALCYTASCTNASCSG

Rat                           DCVEIYIQRPKDSGMWNDERCDKKKLALCYTASCTNTSCSG

Pig                           DCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSG

Bovine                        DCVEIYIKREKDSGKWNDEKCTKQKLALCYKAACNPTPCGS

Rabbit                        DCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSG

Horse                         DCVEIYIKRYKDAGKWNDENCNKKKLALCYTAACTHTSCSG

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	22 – 610	E-selectin
Topological domain	22 – 556	Extracellular
Domain	22 – 139	C-type lectin
Binding site	126 – 126
Binding site	127 – 127
Glycosylation	145 – 145	N-linked (GlcNAc...) asparagine
Disulfide bond	40 – 138
Disulfide bond	111 – 130

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.