Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P30556: Variant p.Cys289Trp

Type-1 angiotensin II receptor
Gene: AGTR1
Feedback?
Variant information Variant position: help 289 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Tryptophan (W) at position 289 (C289W, p.Cys289Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 289 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 359 The length of the canonical sequence.
Location on the sequence: help GIIRDCRIADIVDTAMPITI C IAYFNNCLNPLFYGFLGKKF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKF

                              GIIHDCKIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKF

Chimpanzee                    GIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKF

Pig                           GIIHDCKIADIVDTAMPITICLAYFNNCLNPLFYGFLGKKF

Bovine                        GLIRDCKIEDIVDTAMPITICLAYFNNCLNPLFYGFLGKKF

Rabbit                        GVIHDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKF

Sheep                         GLIRDCKIEDIVDTAMPITICLAYFNNCLNPPFYGFLGKKF

Chicken                       HVITDCKITDIVDTAMPFTICIAYFNNCLNPFFYVFFGKNF

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 359 Type-1 angiotensin II receptor
Transmembrane 279 – 304 Helical; Name=7
Mutagenesis 284 – 284 M -> A. Slightly affects binding to eprosartan inhibitor.
Mutagenesis 285 – 285 P -> A. Decreased binding to eprosartan inhibitor.
Mutagenesis 288 – 288 I -> A. Decreased binding to eprosartan inhibitor.
Mutagenesis 292 – 292 Y -> A. Mimics the disordered side chain induced by angiotensin II-binding; increased affinity for G protein subunit alpha proteins. Decreased affinity for telmisartan.
Helix 274 – 295



Literature citations
Novel subtype of human angiotensin II type 1 receptor: cDNA cloning and expression.
Konishi H.; Kuroda S.; Inada Y.; Fujisawa Y.;
Biochem. Biophys. Res. Commun. 199:467-474(1994)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT TRP-289;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.