Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P05091: Variant p.Glu337Val

Aldehyde dehydrogenase, mitochondrial
Gene: ALDH2
Feedback?
Variant information Variant position: help 337 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamate (E) to Valine (V) at position 337 (E337V, p.Glu337Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (E) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Genetic variation in ALDH2 is responsible for individual differences in responses to drinking alcohol [MIM:610251]. Allele ALDH2*2 is associated with a very high incidence of acute alcohol intoxication in Orientals and South American Indians, as compared to Caucasians (PubMed:39075523, PubMed:6582480). Allele ALDH2*2 is also associated with impaired efficacy of sublingual nitroglycerin in the treatment of angina and heart failure (PubMed:16440063). Additional information on the polymorphism described.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 337 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 517 The length of the canonical sequence.
Location on the sequence: help QCCCAGSRTFVQEDIYDEFV E RSVARAKSRVVGNPFDSKTE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         QCCCAGSRTFVQEDIYDEFVE--RSVARAKSRVVGN--PFDSKTE

Mouse                         QCCCAGSRTFVQENVYDEFVE--RSVARAKSRVVGN--PFD

Rat                           QCCCAGSRTFVQEDVYDEFVE--RSVARAKSRVVGN--PFD

Pig                           QCCCAGSRTFVQEDIYAEFVE--RSVARARSRVVGN--PFD

Bovine                        QCCCAGSRTFVQEDIYAEFVE--RSVARAKSRVVGN--PFD

Horse                         QCCGAGSRTFVQEDVYAEFVE--RSVARAKSRVVGN--PFD

Baker's yeast                 QNCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFD

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 18 – 517 Aldehyde dehydrogenase, mitochondrial
Active site 319 – 319 Nucleophile
Binding site 318 – 318
Binding site 319 – 319
Binding site 320 – 320
Mutagenesis 319 – 319 C -> S. Loss of acetaldehyde dehydrogenase (NAD+) activity. Loss of oxidoreductase activity toward nitroglycerin. Loss of in vitro esterase activity.
Helix 329 – 345



Literature citations
Human aldehyde dehydrogenase isozymes and alcohol sensitivity.
Agarwal D.P.; Goedde H.W.;
Isozymes Curr. Top. Biol. Med. Res. 16:21-48(1987)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 214-500; VARIANT VAL-337;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.