UniProtKB/Swiss-Prot P12235 : Variant p.Val289Met
ADP/ATP translocase 1
Gene: SLC25A4
Feedback ?
Variant information
Variant position:
289
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
LP/P [Disclaimer : Variants classification is intended for research purposes only, not for clinical and diagnostic use . The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant. ]
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
From Valine (V) to Methionine (M) at position 289 (V289M, p.Val289Met).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution). More information can be found on the following page
Variant description:
In PEOA2; inverted direction of ADP:ATP transport, with ATP entering the mitochondrial matrix.
Any additional useful information about the variant.
Other resources:
Links to websites of interest for the variant.
Sequence information
Variant position:
289
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
298
The length of the canonical sequence.
Location on the sequence:
AFFKGAWSNVLRGMGGAFVL
V LYDEIKKYV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human AF--------------------------------FKGA----------------------------WSNVLRGMGGAFV-----LV LYDE------------------------------------------------------IKKYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Mouse AF----------------------------
Rat AF----------------------------
Bovine AF----------------------------
Rabbit AF----------------------------
Caenorhabditis elegans AFGRPLLPIESIHSEKWSEWGPCSVTCGSG
Baker's yeast SL----------------------------
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
2 – 298
ADP/ATP translocase 1
Transmembrane
274 – 291
Helical; Name=6
Repeat
212 – 297
Solcar 3
Modified residue
272 – 272
N6-succinyllysine
Literature citations
adPEO mutations in ANT1 impair ADP-ATP translocation in muscle mitochondria.
Kawamata H.; Tiranti V.; Magrane J.; Chinopoulos C.; Manfredi G.;
Hum. Mol. Genet. 20:2964-2974(2011)
Cited for: FUNCTION; TRANSPORTER ACTIVITY; ACTIVITY REGULATION; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS PEOA2 PRO-114 AND MET-289;
Role of adenine nucleotide translocator 1 in mtDNA maintenance.
Kaukonen J.; Juselius J.K.; Tiranti V.; Kyttala A.; Zeviani M.; Comi G.P.; Keranen J.; Peltonen L.; Suomalainen A.;
Science 289:782-785(2000)
Cited for: VARIANTS PEOA2 PRO-114 AND MET-289;
Mutations of ANT1, Twinkle, and POLG1 in sporadic progressive external ophthalmoplegia (PEO).
Agostino A.; Valletta L.; Chinnery P.F.; Ferrari G.; Carrara F.; Taylor R.W.; Schaefer A.M.; Turnbull D.M.; Tiranti V.; Zeviani M.;
Neurology 60:1354-1356(2003)
Cited for: VARIANT PEOA2 MET-289;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.