UniProtKB/Swiss-Prot Q9UMX9: Variant p.Leu374Phe

Membrane-associated transporter protein
Gene: SLC45A2
Feedback?

Variant information Variant position:

374 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Leucine (L) to Phenylalanine (F) at position 374 (L374F, p.Leu374Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (L) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Genetic variants in SLC45A2 define the skin/hair/eye pigmentation variation locus 5 (SHEP5) [MIM:227240]. Hair, eye and skin pigmentation are among the most visible examples of human phenotypic variation, with a broad normal range that is subject to substantial geographic stratification. In the case of skin, individuals tend to have lighter pigmentation with increasing distance from the equator. By contrast, the majority of variation in human eye and hair color is found among individuals of European ancestry, with most other human populations fixed for brown eyes and black hair. Additional information on the polymorphism described.
Variant description:

Protective factor against melanoma; correlated with dark hair, skin and eye color in Caucasians; decreased protein stability; no effect on subcellular location. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs16891982 [ dbSNP | Ensembl ]

Sequence information Variant position:

374 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

530 The length of the canonical sequence.
Location on the sequence:

AHNSTEFLIYERGVEVGCWG L CINSVFSSLYSYFQKVLVSY The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AHNSTEFLIYERGVEVGCWGLCINSVFSSLYSYFQKVLVSY

Mouse                         AHNSTEFLIYERGVEVGCWGLCINSVFSSVYSYFQKAMVSY

Pig                           AHNSTEFLIYQRGVEVGCWGLCINSVFSSLYSYFQKALVPY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 530	Membrane-associated transporter protein
Transmembrane	367 – 387	Helical; Name=8
Glycosylation	356 – 356	N-linked (GlcNAc...) asparagine

Literature citations
Use of an in vitro immunoselected tumor line to identify shared melanoma antigens recognized by HLA-A*0201-restricted T cells.
Harada M.; Li Y.F.; El-Gamil M.; Rosenberg S.A.; Robbins P.F.;
Cancer Res. 61:1089-1094(2001)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT PHE-374; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4); VARIANT PHE-374; Mutations in the human orthologue of the mouse underwhite gene (uw) underlie a new form of oculocutaneous albinism, OCA4.
Newton J.M.; Cohen-Barak O.; Hagiwara N.; Gardner J.M.; Davisson M.T.; King R.A.; Brilliant M.H.;
Am. J. Hum. Genet. 69:981-988(2001)
Cited for: VARIANT PHE-374; INVOLVEMENT IN OCA4; Mutations in the MATP gene in five German patients affected by oculocutaneous albinism type 4.
Rundshagen U.; Zuehlke C.; Opitz S.; Schwinger E.; Kaesmann-Kellner B.;
Hum. Mutat. 23:106-110(2004)
Cited for: VARIANTS OCA4 ALA-58; CYS-202; PHE-221 DEL; CYS-317; PRO-361; THR-477 AND VAL-486; VARIANTS LYS-272 AND PHE-374; MATP polymorphisms in Germans and Japanese: the L374F mutation as a population marker for Caucasoids.
Yuasa I.; Umetsu K.; Watanabe G.; Nakamura H.; Endoh M.; Irizawa Y.;
Int. J. Legal Med. 118:364-366(2004)
Cited for: VARIANTS LYS-272; PHE-374 AND LEU-507; Single nucleotide polymorphisms in the MATP gene are associated with normal human pigmentation variation.
Graf J.; Hodgson R.; van Daal A.;
Hum. Mutat. 25:278-284(2005)
Cited for: VARIANTS LYS-272 AND PHE-374; Distribution of the F374 allele of the SLC45A2 (MATP) gene and founder-haplotype analysis.
Yuasa I.; Umetsu K.; Harihara S.; Kido A.; Miyoshi A.; Saitou N.; Dashnyam B.; Jin F.; Lucotte G.; Chattopadhyay P.K.; Henke L.; Henke J.;
Ann. Hum. Genet. 70:802-811(2006)
Cited for: VARIANT PHE-374; A genomewide association study of skin pigmentation in a South Asian population.
Stokowski R.P.; Pant P.V.K.; Dadd T.; Fereday A.; Hinds D.A.; Jarman C.; Filsell W.; Ginger R.S.; Green M.R.; van der Ouderaa F.J.; Cox D.R.;
Am. J. Hum. Genet. 81:1119-1132(2007)
Cited for: VARIANT PHE-374; ASSOCIATION WITH SHEP5; SLC45A2 variations in Indian oculocutaneous albinism patients.
Sengupta M.; Chaki M.; Arti N.; Ray K.;
Mol. Vis. 13:1406-1411(2007)
Cited for: VARIANTS OCA4 ILE-42; SER-64; ASN-157; SER-302 AND CYS-348; VARIANTS LYS-272 AND PHE-374; Variants of the MATP/SLC45A2 gene are protective for melanoma in the French population.
Guedj M.; Bourillon A.; Combadieres C.; Rodero M.; Dieude P.; Descamps V.; Dupin N.; Wolkenstein P.; Aegerter P.; Lebbe C.; Basset-Seguin N.; Prum B.; Saiag P.; Grandchamp B.; Soufir N.; Saiag P.; Lebbe C.; Basset Seguin N.; Wolkenstein P.; Dupin N.; Descamps V.; Verola O.; Aegerter P.; Soufir N.;
Hum. Mutat. 29:1154-1160(2008)
Cited for: VARIANTS LYS-272 AND PHE-374; ASSOCIATION WITH SHEP5; INVOLVEMENT IN SUSCEPTIBILITY TO MELANOMA; SLC45A2: a novel malignant melanoma-associated gene.
Fernandez L.P.; Milne R.L.; Pita G.; Aviles J.A.; Lazaro P.; Benitez J.; Ribas G.;
Hum. Mutat. 29:1161-1167(2008)
Cited for: VARIANT PHE-374; ASSOCIATION WITH SHEP5; INVOLVEMENT IN SUSCEPTIBILITY TO MELANOMA; SLC45A2 protein stability and regulation of melanosome pH determine melanocyte pigmentation.
Le L.; Escobar I.E.; Ho T.; Lefkovith A.J.; Latteri E.; Haltaufderhyde K.D.; Dennis M.K.; Plowright L.; Sviderskaya E.V.; Bennett D.C.; Oancea E.; Marks M.S.;
Mol. Biol. Cell 31:2687-2702(2020)
Cited for: VARIANT PHE-374; CHARACTERIZATION OF VARIANT PHE-374; POLYMORPHISM; FUNCTION; SUBCELLULAR LOCATION; TISSUE SPECIFICITY; DEVELOPMENTAL STAGE;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.