Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O60931: Variant p.Lys292Arg

Cystinosin
Gene: CTNS
Feedback?
Variant information Variant position: help 292 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Lysine (K) to Arginine (R) at position 292 (K292R, p.Lys292Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are large size and basic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Found in patients with cystinosis; uncertain significance. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 292 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 367 The length of the canonical sequence.
Location on the sequence: help IKLAVTLVKYFPQAYMNFYY K STEGWSIGNVLLDFTGGSFS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         IKLAVTLVKYFPQAYMNFYYKSTEGWSIGNVLLDFTGGSFS

Mouse                         IKLIITLIKYFPQAYMNFYYKSTKGWSIGGVLLDFTGGSFS

Bovine                        IKLAVTLVKYFPQAYMNFHYKSTEGWSIGNVLLDFTGGSFS

Caenorhabditis elegans        IKMAVTCCKYFPQAYFNYTRKSTVGWSIGNIMLDFTGGTLD

Drosophila                    VKLTITIIKYVPQALMNYRRKSTSGWSIGNILLDFTGGTLS

Slime mold                    VKLFITFIKYIPQAYLNFKNKSTSGWSVHNVLLDFSGGVLS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 23 – 367 Cystinosin
Topological domain 290 – 298 Cytoplasmic
Domain 263 – 328 PQ-loop 2
Binding site 273 – 273
Binding site 280 – 280
Binding site 281 – 281
Binding site 301 – 301
Binding site 305 – 305 protonated residue following cystine-binding
Binding site 305 – 305
Mutagenesis 273 – 273 K -> Q. Abolished cystine transport.
Mutagenesis 274 – 274 L -> F. Gain-of-function mutant that shows higher transport of cystine.
Mutagenesis 281 – 281 Y -> F. Strongly decreased cystine transport. Decreased midpoint potential. Accelerated the time course.
Mutagenesis 284 – 284 Q -> A. Increased cystine uptake activity.
Mutagenesis 289 – 298 Missing. In delta(B) mutant; does not abolish localization to the lysosome; when associated with deletion of 362-G--L-366.
Mutagenesis 301 – 301 N -> A. Strongly decreased cystine transport.
Mutagenesis 305 – 305 D -> E. Abolished steady-state transport current.
Mutagenesis 305 – 305 D -> N. Abolished cystine transport. Abolished transient cxurrents. Abolished steady-state transport current.
Mutagenesis 309 – 309 G -> CS. Gain-of-function mutant that shows higher transport of cystine.
Mutagenesis 312 – 312 S -> N. Gain-of-function mutant that shows higher transport of cystine.



Literature citations
CTNS mutations in an American-based population of cystinosis patients.
Shotelersuk V.; Larson D.; Anikster Y.; McDowell G.; Lemons R.; Bernardini I.; Guo J.; Thoene J.; Gahl W.A.;
Am. J. Hum. Genet. 63:1352-1362(1998)
Cited for: VARIANTS CTNS ASP-169; ARG-182; ASN-205; ASP-205 DEL; ASN-298; GLY-305; ARG-308 AND ARG-339; VARIANT CTNSJAN 67-ILE--PRO-73 DEL; VARIANT ARG-292;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.