UniProtKB/SwissProt variant VAR

Variant information

Variant position:

329

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Glycine (G) to Valine (V) at position 329 (G329V, p.Gly329Val).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from glycine (G) to medium size and hydrophobic (V)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-3

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Leukodystrophy with vanishing white matter (VWM) [MIM:603896]: A leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy. {ECO:0000269|PubMed:11704758, ECO:0000269|PubMed:12707859, ECO:0000269|PubMed:15776425, ECO:0000269|PubMed:21484434, ECO:0000269|PubMed:22285377, ECO:0000269|PubMed:22729508}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In VWM.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs113994020 [ dbSNP | Ensembl ]

Sequence information

Variant position:

329

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

351

The length of the canonical sequence.

Location on the sequence:

HCPVFDYVPPELITLFISNI G GNAPSYIYRLMSELYHPDDH

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         HCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDH

Mouse                         HCPVFDYVPPDLITLFISNIGGNAPSYIYRLMSELYHPDDH

Rat                           HCPVFDYVPPDLITLFISNIGGNAPSYVYRLMSELYHPDDH

Bovine                        HCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDH

Rabbit                        HCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPEDH

Slime mold                    YNPTFDYVAPDLVSLFITNIGGHNPSYIYRLLQEYYDARDI

Baker's yeast                 VNQITDYVPPENIDIYITNVGGFNPSFIYRIAWDNYKQIDV

Fission yeast                 LNPYYDYIPPDLVDLFITNLGGYPPSYLYRIMNDTYDASDT

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 351	Translation initiation factor eIF-2B subunit beta
Beta strand	329 – 331

Literature citations

Subunits of the translation initiation factor eIF2B are mutant in leukoencephalopathy with vanishing white matter.
Leegwater P.A.J.; Vermeulen G.; Koenst A.A.M.; Naidu S.; Mulders J.; Visser A.; Kersbergen P.; Mobach D.; Fonds D.; van Berkel C.G.M.; Lemmers R.J.L.F.; Frants R.R.; Oudejans C.B.M.; Schutgens R.B.H.; Pronk J.C.; van der Knaap M.S.;
Nat. Genet. 29:383-388(2001)
Cited for: VARIANTS VWM GLY-213; ARG-273; ASP-316 AND VAL-329;

UniProtKB/Swiss-Prot P49770: Variant p.Gly329Val