Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P13498: Variant p.Gly24Arg

Cytochrome b-245 light chain
Gene: CYBA
Feedback?
Variant information Variant position: help 24 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Arginine (R) at position 24 (G24R, p.Gly24Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CGD4. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 24 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 195 The length of the canonical sequence.
Location on the sequence: help IEWAMWANEQALASGLILIT G GIVATAGRFTQWYFGAYSIV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         IEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIV

Mouse                         IEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIA

Rat                           IEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIV

Pig                           IEWAMWANEQALASGLILMTGGIVATAGQFTQWYLGTYSIA

Bovine                        IEWAMWANEQALASGLILITGGIVATAGQFTQWYLGAYSIA

Rabbit                        IEWAMWANEQALASGLILVAGGIVATAGRFTQWYFGTYAIA

Slime mold                    FKLGNWAAMIGMAACWCLIAGGIMGI--WYERRYIAIYSIC

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 195 Cytochrome b-245 light chain
Transmembrane 8 – 30 Helical
Helix 6 – 30



Literature citations
Molecular analysis of 9 new families with chronic granulomatous disease caused by mutations in CYBA, the gene encoding p22(phox).
Rae J.; Noack D.; Heyworth P.G.; Ellis B.A.; Curnutte J.T.; Cross A.R.;
Blood 96:1106-1112(2000)
Cited for: VARIANTS CGD4 ARG-24; VAL-25; PRO-52; TRP-90 AND ARG-118;
Genetic studies of three Japanese patients with p22-phox-deficient chronic granulomatous disease: detection of a possible common mutant CYBA allele in Japan and a genotype-phenotype correlation in these patients.
Yamada M.; Ariga T.; Kawamura N.; Ohtsu M.; Imajoh-Ohmi S.; Ohshika E.; Tatsuzawa O.; Kobayashi K.; Sakiyama Y.;
Br. J. Haematol. 108:511-517(2000)
Cited for: VARIANT CGD4 ARG-24;
Statistical and mutational analysis of chronic granulomatous disease in Japan with special reference to gp91-phox and p22-phox deficiency.
Ishibashi F.; Nunoi H.; Endo F.; Matsuda I.; Kanegasaki S.;
Hum. Genet. 106:473-481(2000)
Cited for: VARIANTS CGD4 ARG-24 AND VAL-124;
Clinical, functional, and genetic characterization of chronic granulomatous disease in 89 Turkish patients.
Koker M.Y.; Camcioglu Y.; van Leeuwen K.; Kilic S.S.; Barlan I.; Yilmaz M.; Metin A.; de Boer M.; Avcilar H.; Patiroglu T.; Yildiran A.; Yegin O.; Tezcan I.; Sanal O.; Roos D.;
J. Allergy Clin. Immunol. 132:1156-1163(2013)
Cited for: VARIANTS CGD4 ARG-24; ASP-25; VAL-124 AND THR-125;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.