Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P52701: Variant p.Glu220Asp

DNA mismatch repair protein Msh6
Gene: MSH6
Feedback?
Variant information Variant position: help 220 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamate (E) to Aspartate (D) at position 220 (E220D, p.Glu220Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and acidic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 220 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1360 The length of the canonical sequence.
Location on the sequence: help SEPEEEEEMEVGTTYVTDKS E EDNEIESEEEVQPKTQGSRR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR

Mouse                         SEPEEEEETEVHEAYLSDKSEEDNYNESEEEAQPSVQGPRR

Chicken                       SDTEEAEEEEMEQMSGSASGDSDDSN-SEEDVKGNKRVPNR

Drosophila                    -QPESDSEPEME-----------------------------

Slime mold                    FSRFKDEKPKTTTTLSTPSKPL-------------SQPQRN

Baker's yeast                 AESDDDDSDTTFTA---------------------------

Fission yeast                 ENSELSEVDKPFIASRRSRKPV-----SYAESDEDEDFDDA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1360 DNA mismatch repair protein Msh6
Region 195 – 362 Disordered
Modified residue 200 – 200 Phosphoserine
Modified residue 219 – 219 Phosphoserine
Modified residue 227 – 227 Phosphoserine
Alternative sequence 1 – 302 Missing. In isoform 4.



Literature citations
Germ-line msh6 mutations in colorectal cancer families.
Kolodner R.D.; Tytell J.D.; Schmeits J.L.; Kane M.F.; Das Gupta R.; Weger J.; Wahlberg S.; Fox E.A.; Peel D.; Ziogas A.; Garber J.E.; Syngal S.; Anton-Culver H.; Li F.P.;
Cancer Res. 59:5068-5074(1999)
Cited for: VARIANTS CRC ILE-285; ARG-566; GLY-803 AND THR-1087; VARIANTS GLU-39; ASP-220; VAL-396 AND LEU-800;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.