Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P54278: Variant p.Glu705Lys

Mismatch repair endonuclease PMS2
Gene: PMS2
Feedback?
Variant information Variant position: help 705 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glutamate (E) to Lysine (K) at position 705 (E705K, p.Glu705Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (E) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MMRCS4 and LYNCH4; decreased DNA mismatch repair activity; decreased protein stability. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 705 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 862 The length of the canonical sequence.
Location on the sequence: help GFIITKLNEDIFIVDQHATD E KYNFEMLQQHTVLQGQRLIA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         GFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIA

Mouse                         GFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLIT

Chicken                       GFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIA
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 862 Mismatch repair endonuclease PMS2
Alternative sequence 184 – 862 Missing. In isoform 4.
Alternative sequence 573 – 862 Missing. In isoform 3.



Literature citations
PMS2 variant results in loss of ATPase activity without compromising mismatch repair.
D'Arcy B.M.; Arrington J.; Weisman J.; McClellan S.B.; Vandana X.; Yang Z.; Deivanayagam C.; Blount J.; Prakash A.;
Mol. Genet. Genomic Med. 10:e1908-e1908(2022)
Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 1-365; INTERACTION WITH MLH1; CHARACTERIZATION OF VARIANTS GLU-232; ARG-238; SER-335; HIS-699; LYS-705; ARG-779; GLN-799 AND GLU-816; CHARACTERIZATION OF VARIANT LYNCH4 42-LEU--GLU-44 DEL; Drastic genetic instability of tumors and normal tissues in Turcot syndrome.
Miyaki M.; Nishio J.; Konishi M.; Kikuchi-Yanoshita R.; Tanaka K.; Muraoka M.; Nagato M.; Chong J.-M.; Koike M.; Terada T.; Kawahara Y.; Fukutome A.; Tomiyama J.; Chuganji Y.; Momoi M.; Utsunomiya J.;
Oncogene 15:2877-2881(1997)
Cited for: VARIANT MMRCS4 LYS-705; The clinical phenotype of Lynch syndrome due to germ-line PMS2 mutations.
Senter L.; Clendenning M.; Sotamaa K.; Hampel H.; Green J.; Potter J.D.; Lindblom A.; Lagerstedt K.; Thibodeau S.N.; Lindor N.M.; Young J.; Winship I.; Dowty J.G.; White D.M.; Hopper J.L.; Baglietto L.; Jenkins M.A.; de la Chapelle A.;
Gastroenterology 135:419-428(2008)
Cited for: VARIANTS LYNCH4 ASN-46; ILE-46; PRO-205; ILE-622; ALA-663; LYS-705; ASP-750 AND TYR-843; VARIANT LEU-563; Inactivation of DNA mismatch repair by variants of uncertain significance in the PMS2 gene.
Drost M.; Koppejan H.; de Wind N.;
Hum. Mutat. 34:1477-1480(2013)
Cited for: CHARACTERIZATION OF VARIANTS VAL-18; GLN-20; ALA-41; GLU-60; THR-423; LYS-485; ALA-511; MET-511; GLU-541; LEU-563; ILE-571; SER-597 AND ALA-857; CHARACTERIZATION OF VARIANTS LYNCH4 ASN-46; ILE-46; PRO-205; GLU-207; VAL-263; GLN-479; ILE-622; ALA-663; LYS-705; ASP-750; ARG-797 AND TYR-843; MUTAGENESIS OF GLU-41 AND TYR-519;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.