Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O43542: Variant p.Thr241Met

DNA repair protein XRCC3
Gene: XRCC3
Feedback?
Variant information Variant position: help 241 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Threonine (T) to Methionine (M) at position 241 (T241M, p.Thr241Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (T) to medium size and hydrophobic (M) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CMM6; likely benign; no effect on function in double-strand break repair via homologous recombination; able to complement DNA repair defects when expressed in XRCC3-deficients cells. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 241 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 346 The length of the canonical sequence.
Location on the sequence: help CEFDSQASAPRARHLQSLGA T LRELSSAFQSPVLCINQVTE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         CEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTE

Mouse                         CEFHLQASAIRAKLLLSLGATLRRLSSTFRSPVLCINQVTD

Bovine                        CEFDGAALALRAQRLLALGAELRRLSCAFRSPVLCVNQVTE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 346 DNA repair protein XRCC3



Literature citations
XRCC2 and XRCC3, new human Rad51-family members, promote chromosome stability and protect against DNA cross-links and other damages.
Liu N.; Lamerdin J.E.; Tebbs R.S.; Schild D.; Tucker J.D.; Shen M.R.; Brookman K.W.; Siciliano M.J.; Walter C.A.; Fan W.; Narayana L.S.; Zhou Z.-Q.; Adamson A.W.; Sorensen K.J.; Chen D.J.; Jones N.J.; Thompson L.H.;
Mol. Cell 1:783-793(1998)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]; VARIANT MET-241; Submission
NIEHS SNPs program;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS HIS-94 AND MET-241; A variant within the DNA repair gene XRCC3 is associated with the development of melanoma skin cancer.
Winsey S.L.; Haldar N.A.; Marsh H.P.; Bunce M.; Marshall S.E.; Harris A.L.; Wojnarowska F.; Welsh K.I.;
Cancer Res. 60:5612-5616(2000)
Cited for: VARIANT CMM6 MET-241; INVOLVEMENT IN CMM6; DNA repair gene XRCC3 241Met variant is not associated with risk of cutaneous malignant melanoma.
Duan Z.; Shen H.; Lee J.E.; Gershenwald J.E.; Ross M.I.; Mansfield P.F.; Duvic M.; Strom S.S.; Spitz M.R.; Wei Q.;
Cancer Epidemiol. Biomarkers Prev. 11:1142-1143(2002)
Cited for: VARIANT CMM6 MET-241; Variant XRCC3 implicated in cancer is functional in homology-directed repair of double-strand breaks.
Araujo F.D.; Pierce A.J.; Stark J.M.; Jasin M.;
Oncogene 21:4176-4180(2002)
Cited for: CHARACTERIZATION OF VARIANT CMM6 MET-241; XRCC3 T241M polymorphism and melanoma skin cancer risk: A meta-analysis.
Fan J.; Fan Y.; Kang X.; Zhao L.;
Oncol. Lett. 9:2425-2429(2015)
Cited for: VARIANT CMM6 MET-241; Quantitative assessment of the influence of X-ray repair cross-complementing group 3 rs861539 polymorphism and cutaneous melanoma susceptibility.
Zeng Y.; Ma F.; Gao W.; Wang Y.; Liu C.;
Arch. Dermatol. Res. 308:173-181(2016)
Cited for: VARIANT CMM6 MET-241;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.